KEGG   Macaca mulatta (rhesus monkey): 693612
Entry
693612            CDS       T01028                                 

Gene name
RYR1
Definition
(RefSeq) ryanodine receptor 1 isoform X1
  KO
K04961  ryanodine receptor 1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04020  Calcium signaling pathway
mcc04371  Apelin signaling pathway
mcc04713  Circadian entrainment
mcc04730  Long-term depression
mcc04921  Oxytocin signaling pathway
mcc05017  Spinocerebellar ataxia
mcc05020  Prion disease
mcc05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    693612 (RYR1)
   04020 Calcium signaling pathway
    693612 (RYR1)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    693612 (RYR1)
  09156 Nervous system
   04730 Long-term depression
    693612 (RYR1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    693612 (RYR1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    693612 (RYR1)
   05020 Prion disease
    693612 (RYR1)
   05022 Pathways of neurodegeneration - multiple diseases
    693612 (RYR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcc01009]
    693612 (RYR1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    693612 (RYR1)
   04040 Ion channels [BR:mcc04040]
    693612 (RYR1)
Protein phosphatases and associated proteins [BR:mcc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     693612 (RYR1)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   693612 (RYR1)
Ion channels [BR:mcc04040]
 Voltage-gated cation channels
  Ryanodine receptor
   693612 (RYR1)
SSDB
Motif
Pfam: RYDR_ITPR RyR RR_TM4-6 Ins145_P3_rec SPRY MIR RIH_assoc Ion_trans EF-hand_7 Presenilin
Other DBs
NCBI-GeneID: 693612
NCBI-ProteinID: XP_028695840
Ensembl: ENSMMUG00000002897
LinkDB
Position
19
AA seq 5040 aa
MADAEGEDDVQFLRTDDEVVLQCSATVLKEQLKLCLAAEGFGNRLCFLEPTSNAQNVPPD
LAICCFVLEQSLSVRALQEMLANTVEAGVEALNLDKWSSQGGGHRTLLYGHAILLRHAHS
RMYLSCLTTSRSMTDKLAFDVGLQEDAIGEACWWTTHPASKQRSEGEKVRVGDDIILVSV
SSERYLHLSTASGELQVDASFMQTLWNMNPICSRCEEGFVTGGHVLRLFHGHMDECLTIS
PADSDDQRRLVYYEGGAVCTHARSLWRLEPLRISWSGSHLRWGQPLRVRHVTTGRYLALT
EDQGLVVVDASKAHTKATSFCFRISKEKLDVAPKRDVEGMGPPEIKYGESLCFVQHVASG
LWLTYAAPDPKALRLGVLKKKAMLHQEGHMDDALSLTRCQQEESQAARMIHSTNGLYNQF
IKSLDSFSGKPRGSGPPAGTALPIEGVILSLQDLIIYFEPPSEDLQHEEKQSKLRSLRNR
QSLFQEEGMLSLVLNCIDRLNVYTTAAHFAEFAGEEAAESWKEIVNLLYELLASLIRGNR
SNCALFSTNLDWLVSKLDRLEASSGILEVLYCVLIESPEVLNIIQENHIKSIISLLDKHG
RNHKVLDVLCSLCVCNGVAVRSNQDLITENLLPGRELLLQTNLINYVTSIRPNIFVGRAE
GTTQYSKWYFEVMVDEVTPFLTAQATHLRVGWALTEGYSPYPGGGEGWGGNGVGDDLYSY
GFDGLHLWTGHVARPVTSPGQHLLAPEDVVSCCLDLSVPSISFRINGCPVQGVFESFNLD
GLFFPVVSFSAGVKVRFLLGGRHGEFKFLPPPGYAPCHEAVLPRERLHLEPIKEYRREGP
RGPHLVGPSRCLSHTDFVPCPVDTVQIVLPPHLERIREKLAENIHELWALTRIEQGWTYG
PVRDDNKRLHPCLVDFHSLPEPERNYNLQMSGETLKTLLALGCHVGMADEKAEDNLKKTK
LPKTYMMSNGYKPAPLDLSHVRLTPAQTTLVDRLAENGHNVWARDRVGQGWSYSAVQDIP
ARRNPRLVPYRLLDEATKRSNRDSLCQAVRTLLGYGYNIEPPDQEPSQVENQSRWDRVRI
FRAEKSYAVQSGRWYFEFEAVTTGEMRVGWARPELRPDVELGADELAYVFNGHRGQRWHL
GSEPFGRPWQPGDVVGCMIDLTENTIIFTLNGEVLMSDSGSETAFREIEIGDGFLPVCSL
GPGQVGHLNLGQDVSSLRFFAICGLQEGFEPFAINMQRPVTTWFSKGLPQFEPVPLEHPH
YEVARVDGTVDTPPCLRLTHRTWGSQNSLVEMLFLRLSLPVQFHQHFRCTAGATPLAPPG
LQPPAEDEARAAEPDPDYENLRRSAGGWGEAENGKEGTAKEGAPGGTPQAGGEAQPARAE
NEKDATTEKNKKRGFLFKAKKVAMMTQPPATPTLPRLPHDVVPADNRDDPEIILNTTTYY
YSVRVFAGQEPSCVWVGWVTPDYHQHDMSFDLSKVRVVTVTMGDEQGNIHSSLKCSNCYM
VWGGDFVSPGQQGRISHTDLVIGCLVDLATGLMTFTANGKESNTFFQVEPNTKLFPAVFV
LPTHQNVIQFELGKQKNIMPLSAAMFQSERKNPAPQCPPRLEMQMLMPVSWSRMPNHFLQ
VETRRAGERLGWAVQCREPLTMMALHIPEENRCMDILELSERLDLQRFHSHTLRLYRAVC
ALGNNRVAHALCSHVDQAQLLHALEDAHLPGPLRAGYYDLLISIHLESACRSRRSMLSEY
IVPLTPETRAITLFPPGRSTENGHPRHGLPGVGVSTSLRPPHHFSAPCFVAALPAAGAAE
APARLSPAIPLEALRDKALRMLGEAVRDGGQHARDPVGGSVEFQFVPVLKLVSTLLVMGI
FGDEDVKQILKMIEPEVFTEEEEEEEEEEEEEEDEEEKEEDEEETAQEKEDEEKEEEEAA
GGEKEEGLEEGLLQMKLPESVKLQMCHLLEYFCDQELQHRVESLAAFAERYVDKLQANQR
SRYGLLMKAFSMTAAETARRTREFRSPPQEQINMLLQFKDGTDEEDCPLPEEIRQDLLDF
HQDLLAHCGIQLDGEEEELEEETTLGSRLMSLLEKVRLVKKEEEKPEEERPAEESKPRSL
QELVSHMVVRWAQEDFVQSPELVRAMFSLLHRQYDGLGELLRALPRAYTISPSSVEDTMS
LLECLGQIRSLLIVQMGPQEENLMIQSIGNIMNNKVFYQHPNLMRALGMHETVMEVMVNV
LGGGESKEIRFPKMVTSCCRFLCYFCRISRQNQRSMFDHLSYLLENSGIGLGMQGSTPLD
VAAASVIDNNELALALQEQDLEKVVSYLAGCGLQSCPMLVAKGYPDIGWNPCGGERYLDF
LRFAVFVNGESVEENANVVVRLLIRKPECFGPALRGEGGSGLLAAIEEAIRISEDPARDG
PGIRRDRRREHFGEEPPEENRVHLGHAIMSFYAALIDLLGRCAPEMHLIQACKGEALRIR
AILRSLVPLEDLVGIISLPLQMPTLGKDGALVQPKMSASFVPDHKASMVLFLDRVYGIEN
QDFLLHVLDVGFLPDMRAAASLDTATFSTTEMALALNRYLCLAVLPLITKCAPLFAGTEH
RAIMVDSMLHTVYRLSRGRSLTKAQRDVIEDCLMALCRYIRPSMLQHLLRRLVFDVPILN
EFAKMPLKLLTNHYERCWKYYCLPTGWANFGVTSEEELHLTRKLFWGIFDSLAHKKYDPE
LYRMAMPCLCAIAGALPPDYVDASYSSKAEKKATVDAEGNFDPRPVETLNVIIPEKLDSF
INKFAEYTHEKWAFDKIQSNWSYGENIDEELKTHPMLRPYKTFSEKDKEIYRWPIKESLK
AMIAWEWTIEKARDGEEEKTEKKKTRKISQSAQTYDPRDGYNPQPPDLSAVTLSRELQAM
AEQLAENYHNTWGRKKKQELEAKGGGTHPLLVPYDTLTAKEKARDREKAQELLKFLQMNG
YAVTRGLKDMELDSSSIEKRFAFGFLQQLLRWMDISQEFIAHLEAVVSSGRVEKSPHEQE
IKFFAKILLPLINQYFTNHCLYFLSTPAKVLGSGGHASNKEKEMITSLFCKLAALVRHRV
SLFGTDAPAVVNCLHILARSLDARTVMKSGPEIVKAGLRSFFESASEDIEKMVENLRLGK
VSQARTQVKGVGQNLTYTTVALLPVLTTLFQHIAQHQFGDDVILDDVQVSCYRTLCSIYS
LGTTKNIYVEKLRPALGECLARLAAAMPVAFLEPQLNEYNACSVYTTKSPRERAILGLPN
SVEEMCPDIPVLERLMADIGGLAESGARYTEMPHVIEIALPMLCSYLPRWWERGPEAPPP
ALPAGAPPPCTAVTSDHLNSLLGNILRIIVNNLGIDEASWMKRLAVFAQPIVSRARPELL
QSHFIPTIGRLRKRAGKVVSEEEQLRLEAKAEAQEGELLVRDEFSVLCRDLYALYPLLIR
YVDNNRAQWLTEPNPSAEELFRMVGEIFIYWSKSHNFKREEQNFVVQNEINNMSFLTADN
KSKMAKAGDTQSGGSDQERTKKKRRGDRYSVQTSLIVATLKKMLPIGLNMCAPTDQDLIT
LAKTRYALKDTDEEVREFLNNNLHLQGKVEGSPSLRWQMALYWGVPGREEDADDPEKIVR
RVQEVSAVLYHLDQTEHPYKSKKAVWHKLLSKQRRRAVVACFRMTPLYNLPTHRACNMFL
ESYKAAWILTEDHSFEDRMIDDLSKAGEQEEEEEEVEEKKPDPLHQLVLHFSRTALTEKS
KLDEDYLYMAYADIMAKSCHLEEGGENGEGEEEVEVSFEEKEMEKQRLLYQQARLHTRGA
AEMVLQMISACKGETGAMVSSTLKLGISILNGGNAEVQQKMLDYLKDKKEVGFFQSIQAL
MQTCSVLDLNAFERQNKAEGLGMVNEDGTVINRQNGEKVMADDEFTQDLFRFLQLLCEGH
NNDFQNYLRTQTGNTTTINIIICTVDYLLRLQESISDFYWYYSGKDVIEEQGKRNFSKAM
SVAKQVFNSLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMMMKLAQDSSQIELLKE
LLDLQKDMVVMLLSLLEGNVVNGTIARQMVDMLVESSSNVEMILKFFDMFLKLKDIVGSE
AFQDYVTDPRGLISKKDFQKAMDSQKQFSGPEIQFLLSCSEADENEMINCEEFANRFQEP
ARDIGFNVAVLLTNLSEHVPHDPRLHNFLELAESILEYFRPYLGRIEIMGASRRIERIYF
EISETNRAQWEMPQVKESKRQFIFDVVNEGGEAEKMELFVSFCEDTIFEMQIAAQISEPE
GEPETDEDEGAAEAGVEGAEESAAGPEGTAATAAAGATARVAAAMGRALRGLSYRSLRRR
VRRLRRLTAREAATAVAALLWAAVTRAGAAGAGAAAGALGLLWGSLFGGGLVEGAKKVTV
TELLAGMPDPTSDEVHGEQPAGPGGDADGEGASEGGGDAAEGAGDEEEAVDEAGPGGADG
AVAVTDGGPFRPEGAGGLGDMGDTTPAEPPTPEGSPILKRKLGVDGVEEELPPEPEPEPE
LEPEKADAENGEKEEVPEPPPEPPKKQAPPSPPPKKEEAGGEFWGELEVQRVKFLNYLSR
NFYTLRFLALFLAFAINFILLFYKVSDSPPGEDDMEGSAAGDVSGAGSGGGSGWGLGAGE
EAEGDEDENMVYYFLEESTGYMEPALRCLSLLHTLVAFLCIIGYNCLKVPLVIFKREKEL
ARKLEFDGLYITEQPEDDDVKGQWDRLVLNTPSFPSNYWDKFVKRKVLDKHGDIYGRERI
AELLGMDLATLEITAHNERKPDPPPGLLTWLMSIDVKYQIWKFGVIFTDNSFLYLGWYMV
MSLLGHYNNFFFAAHLLDIAMGVKTLRTILSSVTHNGKQLVMTVGLLAVVVYLYTVVAFN
FFRKFYNKSEDEDEPDMKCDDMMTCYLFHMYVGVRAGGGIGDEIEDPAGDEYELYRVVFD
ITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVKEDMETKCFICGIGSDYFDTTPHGFET
HTLEEHNLANYMFFLMYLINKDETEHTGQESYVWKMYQERCWDFFPAGDCFRKQYEDQLS
NT seq 15123 nt   +upstreamnt  +downstreamnt
atggctgacgcagaaggcgaggacgacgtccagttcctgcggacggatgatgaggtggtc
ctgcagtgcagcgccaccgtgctcaaggagcagctcaagctctgcctggccgccgagggt
tttggtaaccgcctgtgcttcctggagcccaccagcaacgcccagaatgtgccccctgat
ctggccatctgttgcttcgtcctggagcagtccctgtccgtgcgagccctgcaggagatg
ctggccaacacggtggaggccggcgtggaggccctcaatttggataagtggtcatcccag
ggcgggggacacaggacgctcctgtatggccatgccatcttactccggcacgcacacagc
cgcatgtatctgagctgcctcaccacctcccgctccatgactgacaagctggccttcgat
gtgggactgcaggaggatgcaataggagaggcttgctggtggaccacgcacccagcctcc
aagcagaggtctgaaggagaaaaggtccgtgttggggatgacatcatccttgtcagtgtc
tcttctgaacgctacctgcacctgtcgactgccagcggggagctccaggttgacgcttcc
ttcatgcagacgctgtggaacatgaaccccatctgctcccgctgcgaagagggcttcgtg
acaggaggtcacgtcctccgcctctttcatggacatatggatgagtgtctgaccatttcc
cctgctgacagtgacgaccagcgcagacttgtctactatgaggggggagctgtgtgcacc
cacgcccgctccctctggaggctggagcccctgagaatcagctggagtgggagccaccta
cgctggggccagccactccgagtccggcatgtcaccaccgggcggtacctggcactcacc
gaggaccagggcctggtggtggttgacgccagcaaggcccataccaaggctacgtccttc
tgcttccgcatctccaaggagaagctggatgtggcccccaagcgggatgtggaaggcatg
ggcccccctgagatcaagtacggggagtcactgtgctttgtgcagcatgtggcctcagga
ctgtggctcacctatgccgctccagaccccaaggccctgaggctcggtgtgctcaagaag
aaggccatgctgcaccaggaaggccacatggatgacgcactgtcactgacccgctgccag
caggaggagtcccaggctgcccgcatgatccacagcaccaatggcctgtacaaccagttc
atcaagagcctggacagcttcagcgggaagccacggggctcggggccgccggctggcacg
gcgctgcccatcgagggcgttatcctgagcctgcaggacctcatcatctacttcgagccg
ccctccgaggacttgcagcatgaggagaagcagagcaagctgcgaagcctgcgcaaccgc
cagagtctcttccaggaggaggggatgctctccctggtcctgaattgcattgaccgccta
aatgtctacaccaccgctgcccactttgccgagtttgcaggggaggaggcagccgagtcc
tggaaagagattgtgaatcttctttatgaactcctggcttctctgatccgtggcaatcgt
agcaactgtgccctcttctccacaaacttggactggctggtcagcaagctggatcggctg
gaggcctcatctggcatcctggaggtcctgtactgtgtcctcattgagagtccagaggtt
ctgaacatcatccaggagaatcacatcaagtccatcatctccctcctggacaagcatggg
aggaaccacaaggtcctggacgtgctgtgctccctgtgtgtgtgtaatggtgtggctgta
cgctccaaccaagatcttattactgagaacttgctgcctggccgtgagcttctgctgcag
acaaacctcatcaactatgtcaccagcatccggcccaacatcttcgtgggccgagcggag
ggcaccacgcagtacagcaaatggtactttgaggtgatggtggatgaggtgactccattt
ctgacagctcaggccacccacttgcgggtgggctgggccctcaccgagggctacagcccc
taccctgggggcggcgagggctggggcggcaacggggtcggcgatgacctctattcctac
ggctttgatggactgcatctctggacaggacacgtggcacgcccagtgacttccccaggg
cagcacctcctggcccctgaagacgtagtcagctgctgtctggacctcagcgtgccgtcc
atctccttccgcatcaatggctgccctgtgcagggcgtctttgagtccttcaacctggac
gggcttttcttccctgttgtcagcttctcggctggtgtcaaggtgcggttcctccttggt
ggccgccatggcgaattcaagttcctgcccccacctggctatgccccatgccatgaggct
gtgctccctcgagagcgactccatcttgaacccatcaaggagtatcgacgggaggggccc
cgggggcctcacctggtgggccccagtcgctgcctctcacacaccgactttgtgccctgc
cctgtggacaccgttcagatcgtcctgccaccccatctggagcgcattcgggagaagctg
gcagagaacatccacgagctctgggcgctgacccgcattgagcaaggctggacctatggc
ccggttcgggatgacaacaagaggctgcacccgtgtcttgtggacttccacagccttcca
gagcccgagaggaactacaacctgcagatgtcgggggagacgctcaagactctgctggct
ctgggctgccacgtgggtatggcggatgagaaggcggaggacaacctgaagaagacaaaa
ctccccaagacgtatatgatgagcaatgggtacaagccggctccgctggacctgagccac
gtgcggctgacgccggcgcagacgacactggtggaccgtctggcagaaaatgggcacaac
gtgtgggcccgagaccgtgtgggccagggctggagctacagtgcggtgcaggacatcccc
gcgcgccgaaacccacggctcgtgccctatcgcctcctggacgaggccaccaagcgcagc
aaccgggacagcctctgccaggccgtgcgcaccctcctaggttacggctacaacatcgag
cctcctgaccaggagcccagtcaggtggagaaccagtctcgttgggaccgggtgcgcatc
ttccgggcagagaaatcctatgcagtgcagagcggccgctggtacttcgagtttgaagca
gtcaccacaggcgagatgcgagtgggctgggcgaggcccgagctgaggcctgatgtagag
ctgggagctgatgagctggcctatgtcttcaatgggcaccgcggccagcgctggcacttg
ggtagtgaaccatttgggcgcccctggcagccgggcgatgtcgttggctgtatgatcgac
ctcacagagaacaccattatcttcaccctcaatggcgaggtcctcatgtctgactcgggc
tccgaaacagccttccgggagattgagattggggacggcttcctgcccgtctgcagcttg
ggacctggccaggtgggtcacctgaacctgggccaggacgtgagctccctgcggttcttt
gccatctgtggtctccaggaaggctttgagccatttgccatcaacatgcaacgcccagtc
accacctggttcagcaaaggcctgccccagtttgagccagtgccccttgaacaccctcac
tatgaggtagcccgagtggacggcactgtggacacgcccccgtgtctgcgtctgactcac
cgcacctggggctcccagaacagcctggtggagatgctcttcctgcggctgagcctccca
gtccagttccaccagcacttccgctgcaccgcaggggccaccccgctggcaccccccggc
ctgcagccccctgccgaggacgaggcccgggcggcggaacccgaccctgactacgaaaac
ctgcgccgctcagctgggggctggggcgaggccgagaacggcaaagaagggactgcgaag
gagggcgcccccgggggcaccccgcaggcggggggagaggcacagcccgccagggctgag
aatgagaaggacgccaccaccgagaagaacaagaagagaggcttcttattcaaggccaag
aaggtcgccatgatgacccaaccaccggccacccccacgctgcctcggctccctcacgac
gtggtgcctgcagacaaccgcgatgaccctgagatcatcctcaacaccaccacgtactat
tactccgtgagggtctttgccggacaggagcccagctgcgtgtgggtgggctgggtcact
cctgactaccatcagcacgacatgagcttcgacctcagcaaggtccgggtcgtgacagtg
accatgggggatgaacaaggcaacatccacagcagcctcaagtgcagcaattgctatatg
gtgtggggtggggactttgtgagtcccgggcagcagggccggatcagccacacggatctt
gtcattgggtgcctggtggacttggccactggcttaatgacctttacagccaatggcaaa
gagagcaacacctttttccaggtggaacccaacacaaagctatttcctgctgtcttcgtc
ctgcccacccaccagaacgtcatccagtttgagctggggaagcagaagaacatcatgccg
ttgtcagccgccatgttccagagcgagcgcaagaacccggccccgcagtgcccgccacgg
ctggagatgcagatgctgatgccagtgtcctggagccgcatgcccaaccacttcctgcag
gtggagacgaggcgcgccggcgagcggctgggctgggccgtgcagtgccgggagccgctg
accatgatggcgctgcacatccccgaggagaaccgatgcatggacatcctggagttgtcg
gagcgcctggacctgcagcgcttccactcgcacaccctgcgcctctaccgcgctgtgtgc
gccctgggcaacaatcgcgtggcgcacgctctgtgcagccacgtggaccaggctcagctg
ctgcacgccctggaggacgcgcacctgccaggcccactgcgtgcaggctactacgacctc
ctcattagcatccatctcgaaagtgcctgccgcagccgccgctccatgctctctgaatac
atcgtgcccctcacacctgagacccgcgccatcacgctcttccctcctggaaggagcaca
gaaaatggtcacccccggcacggcctgccgggagttggagtcagcacttcgctgcggcct
ccgcatcatttctcggccccctgtttcgtggccgctctgccagctgctggggcagcagag
gctccggcccgcctcagccccgccatcccgctggaggccctacgggacaaggcactgagg
atgctgggggaggcggtgcgcgacggtgggcagcacgctcgcgatcccgtcgggggctcc
gtggagttccagtttgtgcctgtgctcaagctcgtgtccaccctgctggtgatgggcatc
tttggcgatgaggatgtgaaacagatcttgaagatgattgagcctgaagtcttcactgag
gaagaagaggaggaggaggaagaagaagaggaagaggaagatgaggaggagaaggaggag
gatgaggaggaaacagcacaggaaaaggaagatgaagaaaaagaggaagaggaggcagca
ggaggggagaaggaagaaggcttggaggaggggctgctccagatgaagttgccagagtct
gtgaagttacagatgtgccacctgctggaatatttctgtgaccaagagttgcagcaccgt
gtggagtccctggcagcctttgcggagcgctatgtggacaagctccaggccaaccagcgg
agccgctatggcctcctcatgaaagccttcagcatgaccgcagcggagactgcaagacgt
acccgcgagttccgctccccgccccaggagcagatcaatatgctattgcaattcaaagat
ggtacagatgaggaagactgtcctctccctgaagagatacgacaggatttgcttgacttt
catcaagacctgctggcacactgtggaattcagctggatggagaggaggaggaactagag
gaagagaccaccctgggcagccgcctcatgagccttttggagaaagtgcggctggtgaag
aaggaggaggagaaacctgaggaggagcggccagcagaggagagcaaaccccggtccctg
caggaactggtgtcccacatggtggtgcgctgggcccaagaggacttcgtgcagagcccc
gagctggtgcgggccatgttcagcctcctgcaccggcagtacgacgggctgggtgagctg
ctgcgtgccctgccacgggcgtacaccatctcaccgtcctccgtggaagacaccatgagc
ctgcttgagtgcctcggccagatccgctccctgctcatcgtgcagatgggccctcaggag
gagaacctcatgatccagagcatcgggaacatcatgaacaacaaagtcttctaccaacac
ccgaacctgatgagggcgctgggcatgcacgagacggtcatggaggtcatggtcaacgtc
ctcgggggcggcgagtccaaggagatccgcttccccaagatggtgacaagctgctgccgc
ttcctctgctatttctgccgcatcagccggcagaaccagcgctccatgtttgaccacctg
agctacctgctggagaacagtggcatcggcctgggcatgcagggctccacacccctggat
gtggctgctgcctctgtcattgacaacaatgagctggccttggcgttgcaggagcaggac
ctggaaaaggtcgtgtcctacctggcaggctgtggcctccaaagctgccccatgcttgtg
gccaagggatacccagatattggctggaacccctgcggtggagagcgctacctggacttc
ctgcgcttcgctgtcttcgtaaacggcgagagcgtggaggagaacgccaacgtggtggtg
cggctgctcatccggaagcctgagtgcttcggacccgccctgcggggtgagggtggctca
gggctgctggctgccatcgaagaggccatccgcatctccgaggaccctgcgagggatggc
ccaggcatccgcagggaccggcggcgcgagcacttcggtgaggaaccacctgaagaaaac
cgggtgcacctgggacacgccatcatgtccttctatgccgccttgatcgacctgctcgga
cgctgtgcgccagagatgcatctaatccaagcctgcaagggtgaggccctgcggatccgt
gccatcctccgctcccttgtgcccttggaggacctcgtgggcatcatcagcctcccactg
cagatgcctaccctgggcaaagacggggctctggtgcagccaaagatgtcagcatccttc
gtgccggaccacaaggcgtccatggtgctcttcctggaccgtgtgtacggcatcgagaac
caggacttcttgctgcacgtgctggacgtgggattcctgcccgacatgagggcagccgcc
tcgctggacacggccactttcagcaccaccgagatggcactggcgctgaaccgctacctg
tgcctggccgtgctgcctctcatcaccaagtgtgcgccgctctttgcgggcacggaacac
cgcgccatcatggtggactccatgctgcacacggtgtaccgcctgtcccggggtcgctcg
ctcaccaaggcgcagcgcgacgtcatcgaggactgcctcatggctctctgcaggtacatc
cgcccgtcgatgctgcagcacctgctgcggcgtctggtgttcgacgtgcccatcttaaac
gagtttgccaagatgccactcaagctcctcaccaaccactatgagcgttgttggaagtac
tactgcctacccacaggctgggccaacttcggggtcacctcggaggaggagctgcacctc
acccggaaactcttctggggcatctttgactctctggcccataagaaatacgacccggag
ctttaccgaatggccatgccttgtctgtgtgccatcgctggggctctgccccccgactat
gtggacgcctcatactcatctaaggcggagaaaaaggccacagtggatgctgaaggcaac
tttgatccccggcctgtggaaaccctcaatgtgatcatcccggagaagctggactccttc
attaacaagtttgcggagtatacacatgagaagtgggccttcgacaagatccagagcaac
tggtcctatggagagaacatagatgaggagttgaagacccaccccatgctgaggccctac
aagaccttttcagagaaggacaaagagatttaccgctggcccatcaaggagtccctgaag
gccatgattgcctgggaatggaccatagagaaggccagggacggtgaggaggagaagacg
gaaaagaaaaaaacgcggaagatatcacaaagtgcccagacctacgatcctcgagacggc
tacaacccccagccccccgaccttagcgcagttaccctgtcccgggagctgcaggccatg
gcagaacaactggcggaaaattaccacaacacgtggggaaggaagaagaagcaggagctg
gaagccaaaggcggtgggacccaccccctgctggtcccctacgacacgctaacagccaag
gagaaggcacgagatcgagagaaggcccaggagctgctgaaattcctgcagatgaatggc
tacgcggttacaagaggccttaaggacatggaactggactcgtcttccattgaaaagcgg
tttgcctttggcttcctgcagcagctgctgcgctggatggacatttctcaggagttcatt
gcccacctggaggctgtggtcagcagtgggcgagtggaaaagtccccacatgaacaggag
attaaattctttgccaagatcctgctccctttgatcaaccagtacttcaccaaccactgc
ctctatttcttgtccactcctgctaaagtgctgggcagtggcggccacgcctccaacaag
gagaaggaaatgatcaccagcctcttctgcaaacttgctgctcttgtccgccaccgagtc
tctctctttgggacggacgccccggctgtggttaactgtcttcacatcctggcccgctcc
ctggatgccaggacagtgatgaagtcaggccctgagatcgtgaaggctggcctccgctcc
ttcttcgagagtgcctcggaggacatcgagaagatggtggagaacctgcggctgggcaag
gtgtcacaggcgcgcacccaggtgaagggcgtgggccagaacctcacctacaccaccgtg
gcgctgctgccggtcctcaccaccctcttccagcacatcgcccagcaccagttcggagat
gacgtcatcctggacgacgtccaggtctcttgctaccgaacgctgtgcagtatctactcc
ctgggaaccaccaagaacatttacgtggaaaagcttcggccagccctcggggagtgcctg
gcccgtctggcagcagccatgccggtggcgttcctggagccgcagctgaatgagtacaac
gcctgctccgtgtacaccaccaagtctccccgagagcgggccatcctggggctccccaac
agtgtggaggagatgtgtcctgacatcccggtgctggagcggctcatggcagacatcggg
gggctggccgagtcaggggcccgctacacggagatgccgcacgtcattgagatcgcgctg
ccaatgctctgcagctacctgccccgatggtgggagcgcgggcccgaggcaccccctcct
gccctgcccgctggcgcccccccaccctgcacagctgtcacctccgaccacctcaactcc
ctgctggggaacatcctgagaatcatcgtcaacaacctgggcattgacgaggcctcctgg
atgaagcggctggctgtgttcgcacagcccatcgtgagccgtgcgcggccggagctcctg
cagtcccacttcatccccaccatcgggcggctgcgcaagagggcggggaaggtggtgtcc
gaggaggagcagctgcggctggaggccaaggccgaggcccaggagggcgagctgctggtg
cgagacgagttctccgtgctctgccgggacctgtacgccctgtatccgctgctcatccgc
tatgtggacaacaacagggcgcagtggctgacggagccgaatcccagcgcggaggagctg
ttcaggatggtgggcgagatcttcatctactggtccaagtcccacaacttcaagcgcgag
gagcagaactttgtggtccagaacgagatcaacaacatgtccttcctgactgcggacaac
aagagcaaaatggctaaggcgggagatacacagtccggtggctcggaccaggaacgcacg
aagaagaagcgccgtggggaccggtactccgtgcagacgtcgctgatcgtggccacgctg
aagaagatgctgcccatcggcctgaacatgtgcgcgcccaccgaccaggacctcatcacg
ctggccaagacccgctacgccctgaaagacacagatgaggaggtccgggaatttctgaac
aacaaccttcaccttcagggaaaggtcgaaggctccccgtctctgcgctggcagatggcc
ctgtactggggcgtcccgggtcgtgaggaggacgccgacgacccggagaaaatcgtgcgc
agagtccaggaagtgtcagccgtgctctaccacctggaccagaccgagcacccttacaag
tctaagaaggccgtgtggcacaagcttttgtccaagcagcgccggcgggcagtcgtggcc
tgtttccgtatgacgcccctgtacaacctgcccacgcaccgggcatgtaacatgttcctg
gagagctacaaggctgcatggatcctgactgaagaccacagttttgaggaccgcatgata
gatgacctttcaaaagctggggagcaggaggaggaggaggaagaggtggaagaaaagaag
ccagaccccctgcaccagttggtcctgcacttcagccgcactgccctgacggaaaagagc
aaactggacgaggattacctgtacatggcctatgctgatatcatggcaaagagctgccac
ctggaggagggaggggagaacggcgaaggtgaagaggaggttgaggtctcctttgaggag
aaagagatggagaagcagcggctcctataccagcaagcacggctgcacacccggggggca
gccgagatggtgctgcagatgatcagtgcctgcaaaggagagacaggtgccatggtgtcc
tccaccctgaagctgggcatctccatcctcaatggaggcaatgctgaggtccagcagaaa
atgctggattatcttaaggacaagaaggaagttggcttcttccagagtatccaggcactg
atgcaaacatgcagcgtactggatctcaatgcctttgagagacagaacaaggccgagggg
ctgggcatggtgaacgaggatggcactgtcatcaatcgccagaacggagagaaggtcatg
gcggatgatgaattcacacaagacctgttccgattcctacaattgctctgtgaggggcac
aataatgatttccagaactacctacggacacagacagggaacacgaccactattaacatc
atcatctgcacggtggactacctcctgcggctgcaggaatccatcagcgacttctactgg
tactactcaggcaaggatgtcattgaagagcagggcaagaggaacttctccaaagccatg
tcggtggctaagcaggtgttcaacagcctcactgagtacatccagggcccctgcaccggg
aaccagcagagcctggcgcacagccgcctttgggacgcagtggtgggattcctgcacgtg
ttcgcccacatgatgatgaagctcgctcaggactcaagccagatcgagctgctgaaggag
ctgctggatctgcagaaggacatggtggtgatgttgctgtcgctactagaagggaacgtg
gtaaatggcacgatcgcccggcagatggtggacatgctcgtggaatcctcgtccaatgtg
gagatgatcctcaagttcttcgacatgttcctgaaactcaaggacattgtgggctctgaa
gccttccaggactacgtaacggatccccgtggcctcatctccaagaaggacttccagaag
gccatggacagccagaagcagttcagcggtccagaaatccagttcctgctttcgtgctcc
gaagcggatgagaacgagatgatcaactgcgaggagttcgccaaccgcttccaggagcca
gctcgcgacatcggcttcaacgtggcggtgctgctgaccaacctgtcggagcatgtgccg
catgacccgcgcctgcacaacttcctggagctggccgagagcatcctcgagtacttccgc
ccctacctgggccgcatcgagatcatgggcgcctcgcgccgcatcgagcgcatctacttc
gagatctcggagaccaaccgcgcccagtgggagatgccccaggtgaaggagtccaagcgc
cagttcatcttcgacgtggtgaacgagggcggcgaggccgagaagatggagctcttcgtg
agtttctgcgaggacaccatcttcgagatgcagatcgccgcgcagatctcggagcccgag
ggcgagccggagaccgacgaggacgagggcgcggcggaggcgggcgtggagggcgcggag
gagagcgcggcgggccccgagggcacggcggccacggcggcggcaggggcgacagcgcgg
gtggcggcggccatgggccgggccctgcgcggcctcagctaccgcagcctgcggcggcgc
gtgcggcggctgcggcggctcacggcccgcgaggcggccaccgcggtggcggcgctgctc
tgggcagccgtgacgcgcgcgggggccgctggcgcgggggcggcggcgggcgcgctgggc
ctgctctggggctcgctgttcggcggcggcctggtggagggcgccaagaaggtgacggtg
accgagctcctggcgggcatgcccgaccccaccagcgacgaggtgcacggcgagcagccg
gccgggcccggcggagacgcagacggcgagggtgccagcgaaggcggaggggacgccgcg
gagggcgctggagacgaggaggaggcggtggacgaggccgggccgggcggtgccgacggg
gcggtggccgtgacggatgggggccccttccggcccgaaggggctggcggtctcggggac
atgggggacacgacgcctgcggaaccgcccacgcccgagggctctcccattctcaagagg
aagctgggggtggatggagtggaggaggagctcccgccagagccggagccggaaccagaa
ctggagccggagaaagcagatgccgagaatggggagaaagaagaagttcccgaaccccca
ccagagccccccaagaagcaagcacctccctcaccccctccaaagaaggaagaagctggg
ggtgaattctggggagaactggaggtgcagagggtgaagttcctgaactacctgtcccgg
aacttttacaccctgcggttccttgccctcttcttggcatttgccatcaacttcatcttg
ctgttttataaggtctcagactctccaccaggggaagacgacatggaaggctcagctgct
ggggacgtgtcaggtgcaggctctggtggcggctctggctggggcttgggggccggagag
gaggcagagggcgatgaggatgagaacatggtgtactacttcctggaggagagcacaggc
tacatggagcccgctctgcggtgtctgagcctcctgcatacactggtggcctttctctgc
atcattggctataactgtctcaaggtgcccctggtaatctttaagcgggagaaggagctg
gcccggaagctggagtttgacggcctatacatcacagagcagcccgaggacgatgacgtg
aaggggcagtgggaccgactggtgctcaacacaccgtctttccccagcaactactgggac
aagtttgtcaagcgcaaggtcctggacaaacatggggacatctacgggcgggagcggatt
gctgagctactgggcatggacctggccacactagagatcaccgcccacaatgagcgcaag
cccgacccgccaccagggctgctgacctggctcatgtccatcgatgtcaagtaccagatc
tggaagttcggggtcatcttcacagacaactccttcctgtacctgggctggtatatggtg
atgtccctcttggggcactacaacaacttcttcttcgctgcccatctcctggacatcgcc
atgggggtcaagacgctgcgcaccatcctctcctccgtcacccacaatgggaaacagctg
gtaatgaccgtgggccttctggcggtggtcgtctacctgtacaccgtagtggccttcaac
ttcttccgcaagttctacaacaagagcgaggatgaggatgagcctgacatgaaatgtgac
gacatgatgacgtgttacctgtttcacatgtacgtgggtgtccgggctggcggaggcatt
ggggacgagatcgaggaccccgcgggtgacgaatacgagctctacagggtggtcttcgac
atcaccttcttcttcttcgtcatcgtcatcctgttggccatcatccagggtctgataatc
gacgcttttggtgagctccgagaccaacaagagcaagtgaaggaggatatggagaccaag
tgcttcatctgcggaatcggcagcgactactttgatacgacaccgcatggcttcgagact
cacacgctggaggagcacaacctggccaattacatgtttttcctgatgtatttgataaac
aaggatgagacagaacacacaggtcaggagtcttatgtctggaagatgtaccaagagaga
tgttgggatttcttcccggctggcgattgtttccgcaagcagtatgaggaccagcttagc
tga

KEGG   Macaca mulatta (rhesus monkey): 694996
Entry
694996            CDS       T01028                                 

Gene name
RYR3
Definition
(RefSeq) ryanodine receptor 3 isoform X1
  KO
K04963  ryanodine receptor 3
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04020  Calcium signaling pathway
mcc04371  Apelin signaling pathway
mcc04713  Circadian entrainment
mcc04921  Oxytocin signaling pathway
mcc04970  Salivary secretion
mcc05010  Alzheimer disease
mcc05012  Parkinson disease
mcc05020  Prion disease
mcc05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    694996 (RYR3)
   04020 Calcium signaling pathway
    694996 (RYR3)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    694996 (RYR3)
  09154 Digestive system
   04970 Salivary secretion
    694996 (RYR3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    694996 (RYR3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    694996 (RYR3)
   05012 Parkinson disease
    694996 (RYR3)
   05020 Prion disease
    694996 (RYR3)
   05022 Pathways of neurodegeneration - multiple diseases
    694996 (RYR3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mcc04040]
    694996 (RYR3)
Ion channels [BR:mcc04040]
 Voltage-gated cation channels
  Ryanodine receptor
   694996 (RYR3)
SSDB
Motif
Pfam: RYDR_ITPR RyR RR_TM4-6 SPRY Ins145_P3_rec MIR RIH_assoc Ion_trans EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_5
Other DBs
NCBI-GeneID: 694996
NCBI-ProteinID: XP_014997278
Ensembl: ENSMMUG00000005270
LinkDB
Position
7
AA seq 4870 aa
MAEGGEGGEDEIQFLRTEDEVVLQCIATIHKEQRKFCLAAEGLGNRLCFLEPTSEAKYIP
PDLCVCNFVLEQSLSVRALQEMLANTGENGGEGAAQGGGHRTLLYGHAILLRHSFSGMYL
TCLTTSRSQTDKLAFDVGLREHATGEACWWTIHPASKQRSEGEKVRIGDDLILVSVSSER
YLHLSVSNGNIQVDASFMQTLWNVHPTCSGSSIEEGYLLGGHVVRLFHGHDECLTIPSTD
QNDSQHRRIFYEAGGAGTRARSLWRVEPLRISWSGSNIRWGQAFRLRHLTTGHYLALTED
QGLILQDRAKADTKSTAFSFRASKELKEKLDSSHKRDIEGMGVPEIKYGDSVCFVQHIAS
GLWVTYKAQDAKTSRLGPLKRKVILHQEGHMDDGLTLQRCQREESQAARIIRNTTALFSQ
FVSGNNRTAAPITLPIGEVLQTLQDLIAYFQPPEEEMRHEDKQNKLRSLKNRQNLFKEEG
MLALVLNCIDRLNIYNSVAHFAGIAREESGMAWKEILNLLYKLLAALIRGNRNNCAQFSN
NLDWLISKLDRLESSSGILEVLHCILTESPEALNLIAEGHIKSIISLLDKHGRNHKVLDI
LCSLCLCNGVAVRANQNLICDNLLPRRNLLLQTRLINDVTSIRPNIFLGVAEGSAQYKKW
YFELIIDQVDPFLTAEPTHLRVGWASSSGYAPYPGGGEGWGGNGVGDDLYSYGFDGLHLW
SGRIPRAVASINQHLLRSDDVVSCCLDLGVPSISFRINGQPVQGMFENFNTDGLFFPVMS
FSAGVKVRFLMGGRHGEFKFLPPSGYAPCYEALLPKEKMRLEPVKEYKRDADGVRDLLGT
TQFLSQASFIPCPIDTSQVVLPPHLEKIRDRLAENIHELWGMNKIELGWTFGKIRDDNKR
QHPCLVEFSKLPETEKNYNLQMSTETLKTLLALGCHIAHVNPAAEEDLKKVKLPKNYMMS
NGYKPAPLDLSDVKLLPPQEILVDKLAENAHNVWAKDRIKQGWTYGIQQDLKNKRNPRLV
PYALLDERTKKSNRDSLREAVRTFVGYGYNIEPSDQELADSAMEKVSIDKIRFFRVERSY
AVRSGKWYFEFEVVTGGDMRVGWARPGCRPDVELGADDQAFVFEGSRGQRWHQGSGYFGR
TWQPGDVVGCMINLDDASMIFTLNGELLITNKGSELAFADYEIENGFVPICCLGLSQIGR
MNLGTDASTFKFYTMCGLQEGFEPFAVNMNRDVAMWFSKRLPTFVNVPKDHPHIEVMRID
GTMDSPPCLKVTHKTFGTQHSNADMIYCRLSMPVECHSSFSHSPCLDSEAFQKRKQMQEI
LSHTTTQCYYAIRIFAGQDPSCVWVGWVTPDYHLYSEKFDLNKNCTVTVTLGDERGRVHE
SVKRSNCYMVWGGDIVASSQKSNRSNVDLEIGCLVDLAMGMLSFSANGKELGTCYQVEPN
TKVFPAVFLQPTSTSLFQFELGKLKNAMPLSAAIFKSEEKNPVPQCPPRLDVQTIQPVLW
SRMPNSFLKVESERVSERHGWVVQCLEPLQMMALHIPEENRCVDILELCEQEDLMRFHYH
TLRLYSAVCALGNSRVAYALCSHVDLSQLFYAIDNKYLPGLLRAGFYDLLISIHLANAKE
RKLMMKNEYIIPITSTTRNIRLFPDESKRHGLPGVGLRTCLKPGFRFSTPCFVATGEEHQ
KQSPEIPLESLRTKALSMLTEAVQCSGAHIRDPVGGSVEFQFVPVLKLIGTLLVMGVFDD
DDVRQILLLIDPSVFGEHSADTEEGTEKEEVTQVEEKAVEAGEKAGKEAPVKGLLQTRLP
ESVKLQMCELLSYLCDCELQHRVEAIVAFGDIYVSKLQANQKFRYNELMQALNMSAALTA
RKTKEFRSPPQEQINMLLNFQLGENCPCPEELREELYDFHEDLLLHCGVPLEEEEEEEED
TSWTGKLRALVYKIKGPPKPEKEQPTEEEERCPTTLKELISQTMICWAQEDQIQDAELVR
MMFNLLRRQYDSIGELLQALRKTYTISHASVSDTINLLAALGQIRSLLSVRMGKEEELLM
INGLGDIMNNKVFYQHPNLMRVLGMHETVMEVMVNVLSTEKSQIAFPKMVASCCRFLCYF
CRISRQNQKAMFEHLSYLLENSSVGLASPSMRGSTPLDVAASSVMDNNELALGLEEPDLE
KVVTYLAGCGLQSCPMLLAKGYPDVGWNPIEGERYLSFLRFAVFVNSESVEENASVVVKL
LIRRPECFGPALRGEGGNGLLAAMQGAIKISENPTLDLPSQGYKREVSTEADEEEDEIVH
MGNAIMSFYSALIDLLGRCAPEMHLIQTGKGEAIRIRSILRSLVPTEDLVGIISIPLKLP
SLNKDGSVSEPDMAANFCPDHKAPMVLFLDRVYGIKDQTFLLHLLEVGFLPDLRASASLD
TVSLSTTEAALALNRYICSAVLPLLTRCAPLFAGTEHCTSLIDSTLQTIYRLSKGRSLTK
AQRDTIEECLLAICNHLRPSMLQQLLRRLVFDVPQLNEYCKMPLKLLTNHYEQCWKYYCL
PSGWGSYGLAVEEELHLTEKLFWGIFDSLSHKKYDPDLFRMALPCLSAIAGALPPDYLDT
RITATLEKQISVDADGNFDPKPINTVNFSLPEKLEYIVTKYAEHSHDKWACDKSQSGWKY
GISLDENVKTHPLIRPFKTLTEKEKEIYRWPARESLKTMLAVGWTVERTKEGEALVQQRE
NEKLRSVSQANQGNSYSPAPLDLSNVVLSRELQGMVEVVAENYHNIWAKKKKLELESKGG
GSHPLLVPYDTLTAKEKFKDREKAQDLFKFLQVNGVIVSRGMKDMELDASSMEKRFAYKF
LKKILKYVDSAQEFIAHLEAIVSSGKTEKSPHDQEIKFFAKVLLPLVDQYFTNHRLYFLS
SPLKPLSSSGYASHKEKEMVASLFCKLAALVRHRISLFGSDSTTMVSCLHILAQTLDTRT
VMKSGSELVKAGLRAFFENGAEDLEKTSENLKLGKFTHSRTQIQGVSQNVNYTTVALLPI
LTSIFEHVAQHQFGMDLLLGDVQISCYHILCSLYSLGTGKNIYVERQRPALGECLASLAA
AIPVAFLEPTLNRYNPLSVFNTKTPRERSILGMPDTVEDMCPDIPQLEGLMKEINDLAES
GARYTEVPHVIEVILPMLCNYLSYWWERGPENLPPSTGQCCTKVTSEHLSLILGNILKII
NNNLGIDEASWMKRIAVYAQPIISKARPDLLRSHFIPTLEKLKKKAVKTVQEEEQLRADG
KGDTQEAELLILDEFAVLCRDLYAFYPMLIRYVDNNRSNWLKSPDADSDQLFRMVAEVFI
LWCKSHNFKREEQNFVIQNEINNLAFLTGDSKSKMSKAMQVKSGGQDQERKKTKRRGDLY
SIQTSLIVAALKKMLPIGLNMCTPGDQELISLAKSRYGHRDTDEEVREHLRNNLHLQEKS
DDPAVKWQLNLYKDVLKSEEPFNPEKTVERVQRISAAVFHLEQVEQPLRSKKAVWHKLLS
KQRKRAVVACFRMAPLYNLPRHRSINLFLHGYQRFWIETEEYSFEEKLVQDLAKSPKVEE
EEEEETEKQPDPLHQIILYFSRNALTERSKLEDDPLYTSYSSMMAKSCQSGEDEEADEDK
EKTFEEKEMEKQKTLYQQARLHERGAAEMVLQMISASKGEMSPMVVETLKLGIAILNGGN
AGVQQKMLDYLKEKKDAGFFQSLSGLMQSCSVLDLNAFERQNKAEGLGMVTEEGTLIVRE
RGEKVLQNDEFTRDLFRFLQLLCEGHNSDFQNFLRTQMGNTTTVNVIISTVDYLLRLQES
ISDFYWYYSGKDIIDESGQHNFSKALAVTKQIFNSLTEYIQGPCIGNQQSLAHSRLWDAV
VGFLHVFANMQMKLSQDSSQIELLKELLDLLQDMVVMLLSLLEGNVVNGTIGKQMVDTLV
ESSTNVEMILKFFDMFLKLKDLTSSDTFKEYDPDGKGIISKREFQKAMEGQKQYTQSEID
FLLSCAEADENDMFNYIDFVDRFHEPAKDIGFNVAVLLTNLSEHMPNDSRLKCLLDPAES
VLNYFEPYLGRIEIMGGAKKIERVYFEISESSRTQWEKPQVKESKRQFIFDVVNEGGEQE
KMELFVNFCEDTIFEMQLASQISESDSADRPEEEEEGEDSSYVLEIAGEEEEDGSFEPAS
AFAMACASVKRNVADFLKRATLKNLRKQYRNVKKMTAKELVKVLCSFFWMLFLGLFQMLF
TILGGIFQILWSTVFGGGLVEGAKNIRVTKILGDMPDPTQFGIHDDTMEAERAEVMEPGI
TTELVHFIKGEKGDTDIMSDLFGLHPKKEGSLKHGPEVGLGDLSEIIGKDEPPTLESTVQ
KKRKAQAAEMKAANEAEGKVESEKADVEDGEKEDKDKEEEQAEYLWTEVTKKKKRRCGQK
AEKPEAFTANFFKGLDIYQTKLLHYLARNFYNLRFLALFVAFAINFILLFYKVTEEPLEE
ETEDVANLWNSFNDEEEEEAMVFFVLQESTGYMAPTLRALAIIHTIISLVCVVGYYCLKV
PLVVFKREKEIARKLEFDGLYITEQPSEDDIKGQWDRLVINTPSFPNNYWDKFVKRKVIN
KYGDLYGAERIAELLGLDKNALDFSPVEETKAEAASLVSWLSSIDMKYHIWKLGVVFTDN
SFLYLAWYTTMSVLGHYNNFFFAAHLLDIAMGFKTLRTILSSVTHNGKQLVLTVGLLAVV
VYLYTVVAFNFFRKFYNKSEDDDEPDMKCDDMMTCYLFHMYVGVRAGGGIGDEIEDPAGD
PYEMYRIVFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVREDMETKCFICGIGNDY
FDTTPHGFETHTLQEHNLANYLFFLMYLINKDETEHTGQESYVWKMYQERCWDFFPAGDC
FRKQYEDQLG
NT seq 14613 nt   +upstreamnt  +downstreamnt
atggccgaagggggagaaggaggcgaggacgagatccagtttctgaggactgaggatgaa
gtggtactccagtgcatcgccaccattcacaaggagcagaggaagttctgcctggcagcc
gagggacttgggaatcgcctgtgcttcttggaacccacttcagaagccaagtacattcct
ccagatctctgcgtctgcaattttgtgctggaacagtccctatctgtcagagccctgcag
gaaatgcttgccaacacaggtgaaaatggcggcgaaggggcagcacaaggaggtggccac
aggaccctgttatatggccatgcaattctcctgaggcactctttcagcggaatgtatcta
acatgcttgactacatcaagatcccagacagacaaacttgcctttgatgtaggtctacgg
gaacatgccacaggagaagcctgttggtggactatacatcctgcttccaaacagaggtct
gaaggagagaaagttagaattggcgatgacctcatcctcgtcagcgtgtcctctgaaaga
taccttcatctctcagtatcaaacggtaacatacaagtggatgcctcctttatgcagaca
ctctggaatgtacatcctacgtgctcaggaagtagcatcgaagaaggatacctacttggt
gggcatgtagtgcgtcttttccatggtcatgatgagtgtctgacgataccatctacagac
cagaatgattcccagcacaggaggatattctacgaagctgggggagctgggactcgagcc
aggtctctgtggagagtggaaccacttcggataagttggagtggcagtaacatcagatgg
ggccaggcttttcgactccggcatctcaccacaggccactacctggccttgacagaagac
caaggccttatactacaagaccgggcaaaggcagacaccaagtccacagctttctctttc
cgggcatcaaaggaactcaaggagaaattagattccagtcacaagagagacatagaaggc
atgggagttccggaaatcaagtatggagattctgtctgctttgtacagcatatagccagt
ggtctgtgggtgacctacaaagcacaagatgccaaaacttcccgcctgggacctctgaaa
agaaaggtcatactccatcaggaaggccacatggatgatggattaacactgcagagatgc
cagcgtgaggagtcccaggctgctcggatcatccggaacactacagccttattcagccag
tttgtcagcggaaacaatcgcacagctgcccccatcaccctgcctataggagaagtcctg
cagaccctacaggacttgatcgcctacttccagcccccggaggaggagatgcgacatgaa
gacaagcagaacaagctccgctcactcaaaaacagacaaaatcttttcaaggaagaggga
atgttggctcttgtcttaaattgcattgaccgcttaaatatctacaatagcgtagcacac
tttgcagggattgcaagggaagagagtggcatggcctggaaagaaattctgaacctcctc
tacaaattgctggctgctctcattcgtggaaacagaaacaattgcgctcaattctccaat
aaccttgattggctcatcagtaaattggacagactagaatcttcctcaggtatcttggaa
gttttgcactgcatcttaactgaaagtccggaagccttaaatctgatagcagagggccac
atcaagtccatcatctccctgttggataagcacgggcggaatcacaaggttctggatatc
ctgtgctccctctgtctctgcaatggggttgcagtgagagccaaccagaatctgatctgt
gacaacctgctgccccggagaaacctgctcttgcagacacgactgattaacgatgtaacc
agtatccggccaaacatcttcctgggagtcgcggagggctcagcccagtacaagaagtgg
tacttcgagctgattatcgaccaggtggaccccttcctaacagcagagcccacacatctg
cgtgtgggctgggcctcttcctcaggctatgctccatacccaggcggtggagaaggatgg
ggaggcaatggtgttggcgatgacctgtactcctatggctttgatggacttcacctttgg
tcaggccggatacccagagctgtggcttccatcaaccagcacctcctgagatcagatgat
gtggtaagctgctgcctggacctcggggtgcccagcatttcattccgcatcaatggacaa
cctgtgcaggggatgtttgagaacttcaacacagacgggctcttcttccctgtgatgagc
ttttcagcaggtgtcaaagtacgtttcctgatgggtggacgtcatggagagtttaagttc
ctgcctccctctggctatgccccttgctatgaagccttacttccaaaagagaagatgaga
ttggaacctgtcaaagaatataaacgtgatgctgatggtgttagagatctcttgggtacc
acccagttcctctcccaagcctctttcatcccatgccccatagacaccagtcaggttgtt
ttgccacctcacctcgaaaagatccgagacagactagctgaaaacatccacgagctttgg
ggaatgaataaaatagagcttggctggactttcggcaagatacgagatgacaataaaaga
caacacccttgccttgtggagttttcaaagctccccgaaactgagaagaattataacctg
caaatgtcgactgaaaccttgaaaaccctcctggccctggggtgccacattgctcatgtt
aacccagctgctgaggaggatctcaagaaggtcaaactgcccaaaaactatatgatgtcc
aatggctataagccagcccctttggatttgtctgatgtgaagctgttacctcctcaagaa
attttagtggataagcttgcagaaaatgcgcacaatgtttgggcaaaagacagaataaaa
caaggatggacctatggcatccaacaggatttgaagaacaaaagaaatccccgtctggtg
ccatatgcattactggacgagcgtaccaagaagtcaaacagggacagcctgcgggaagct
gtgcgcacttttgttggttacggatataacattgagccatcagaccaagaactagctgac
tcggctatggagaaagtcagcatagacaagatccgatttttccgggtagagcgatcttat
gcagtgagatctggaaagtggtattttgagtttgaggtggtgactggaggagacatgcga
gttggctgggccaggccaggctgtcggcctgatgtcgagctgggggccgatgaccaagcc
tttgtgtttgaaggcagcaggggccagcgttggcatcaaggaagtgggtattttgggcgt
acgtggcagccaggagatgtggtcggatgtatgattaacctggatgatgcttcaatgatc
ttcacactgaatggggagctgctgatcaccaacaaaggctctgaacttgccttcgctgac
tacgagattgagaatggctttgtgcccatctgctgtctggggctgtctcagattggccgc
atgaatcttgggacagatgccagtaccttcaagttttataccatgtgcggtctccaagag
ggctttgagccttttgctgtcaacatgaacagagatgttgctatgtggttcagcaagcgc
ctcccgacgtttgtcaacgtgccaaaggaccatccacacatagaggtcatgaggattgat
ggcaccatggacagccctccgtgtctcaaggtgacccataagacatttggcacacagcat
agcaatgccgacatgatctactgccgcttgagcatgcctgtcgagtgccactcttccttc
agccacagcccctgtctggacagtgaagctttccagaaaaggaaacagatgcaagaaata
ctctctcatacaacaacacagtgctactatgccatccgcatctttgctggacaagatcca
tcctgcgtctgggtcggatgggtgactccagactatcacttgtacagtgaaaagtttgac
ctgaataaaaactgcacagtgactgtcaccctaggggatgaaagaggccgggtacacgaa
agtgtgaaacgcagcaactgctacatggtctggggcggggacatagtggccagttcccag
aaatcaaatcggagcaacgtggacctggagatcggctgtcttgtggatctggcaatgggc
atgttgtccttctcagccaatggaaaagaactgggcacctgctaccaggtggagcccaac
accaaagtgtttccagcagtcttcctgcagcctacaagtacttccttgtttcagttcgaa
cttggaaagctgaagaatgcaatgcccctgtcggcggccatattcaagagtgaagagaag
aacccagtcccacagtgtccacctcggctggacgtccaaaccatccagcccgtgctctgg
agccgcatgcccaacagcttcctgaaggtggagagcgagcgtgtgagtgagcgccacggc
tgggtggtgcagtgcctggagcccctgcagatgatggcgctccacatccccgaggagaac
aggtgtgtggatatcctggagctctgtgagcaggaggacctgatgcggttccattaccac
acgctgaggctctacagcgcggtgtgcgccctgggaaacagccgtgtggcctacgccttg
tgcagccacgtggacctctcccagctcttctatgccattgacaacaagtacctccccggc
ctccttcgagctggcttctatgacctgctcatcagcatccacctggccaacgccaaggag
aggaagctgatgatgaagaacgagtacatcatccccattaccagcaccaccaggaacatc
cgcctcttcccggacgagtccaagaggcatggactgcctggggtgggcctgagaacatgt
ctcaagcccgggttcaggttctccaccccttgctttgtcgcgactggtgaggagcaccaa
aaacagagccctgagattcccttggagagtctcaggacgaaggctctgagtatgctgaca
gaggcggtgcagtgcagcggggcccacatccgagaccccgtaggggggtctgtggagttc
cagtttgtgcctgtgctgaaactcattggaaccctgctggtcatgggcgtgtttgatgat
gacgatgttcggcagatcctcctcctgattgatccctctgtgtttggggagcatagcgca
gacacagaggagggaacagaaaaggaggaggtgacccaggtggaggagaaggctgtggag
gctggggagaaggccggcaaggaggctcctgtcaaaggcttgttgcagactcgattaccc
gagtccgtcaagctgcagatgtgtgagctcctcagctatctctgcgactgtgagctgcag
caccgagtggaggccattgtggcatttggtgacatttatgtctccaagctgcaggcaaat
cagaagttccgctacaatgagctcatgcaggccctgaacatgtctgcggccttgactgcc
cggaagaccaaggagttccgctcacccccacaggagcagatcaacatgcttcttaacttt
caactgggagagaactgcccctgcccagaggagcttcgggaggagctgtatgatttccat
gaggaccttctccttcactgtggggttcctttggaagaagaggaagaggaggaggaggac
acctcctggacgggaaaactccgtgccttggtttacaaaatcaaaggcccacccaagcca
gagaaggaacagccaacggaggaggaggagagatgccccacaacattgaaggagctcatc
tcacagacgatgatctgctgggcccaggaggaccagatccaggatgcagagctggtccga
atgatgttcaacctcctccggaggcagtatgacagcatcggggagctgctgcaggcgctg
cggaagacctacaccatcagccatgcctctgtaagcgacaccatcaacctgctggctgcc
ctgggccagatccgctccctcctcagtgtcaggatgggcaaggaagaggagttgctcatg
atcaacgggctgggagacataatgaacaacaaggtgttttaccagcatcccaacctcatg
agagtcctgggcatgcacgagacggtgatggaggtgatggtgaacgtgttgagtacagag
aaatctcagattgcatttccgaagatggttgctagctgctgccgtttcctttgctatttc
tgtcgaattagccggcaaaatcagaaggccatgtttgagcatctgagttaccttctggag
aatagcagtgttggcctagcctccccgtcgatgaggggatccaccccgctggatgtggca
gcgtcctctgtgatggacaacaacgagttagcgctgggcttggaggaaccagacctggag
aaggtggtgacctacttggcaggctgtggcctacagagctgccccatgcttctggccaaa
ggataccctgacgtcggctggaaccccatcgaaggggaacgctacctgtccttcctgagg
tttgctgtcttcgtgaacagtgagagtgtggaagaaaatgccagcgttgtggtcaagctg
ctcatcagacgcccagagtgcttcggcccggccctgcggggtgaggggggaaacggactg
ttggcggccatgcagggtgccattaagatctctgagaaccccacgcttgacctcccctct
caaggatacaaaagagaagtcagcacggaggccgatgaagaggaagacgaaatcgtgcat
atgggcaatgcaattatgtcattttattcggcccttatagatctactgggccgctgtgct
cctgaaatgcacctcatccagacgggaaagggggaggccatccgcatcaggtccatactg
cgctccctggtccccacagaagacctggttgggatcatcagcatccccttgaaactgccc
tcccttaacaaagatgggtcggtcagtgagccggatatggcggccaacttctgccctgac
cacaaggcacccatggtgctgttcttggaccgcgtctatggcattaaggatcaaactttt
ctgctccacttgctggaggttggatttttacctgacctgagagcttctgcctctctagat
acagtttccctgagcaccacagaggctgcgcttgcactaaataggtatatatgttctgct
gtgctcccgctcctcacaagatgtgcccctctctttgccggaacagaacactgcacctct
ctgattgattccacactgcagacgatatacaggctttccaagggacgttccctcaccaaa
gcacaaagggacactatagaagaatgtctgcttgccatttgcaatcacttgaggccttcc
atgttacagcagctcctgcgacgcctcgtttttgatgtgccccaactcaatgaatactgc
aaaatgcctctcaagcttctgacgaatcactatgaacagtgctggaaatattactgcctg
ccttcaggatgggggagctatgggctagctgtggaagaagagctgcacctaacggagaag
cttttctgggggatttttgactctctctcccataagaaatatgacccagatcttttccga
atggccctgccttgtctcagtgctatagctggggccttgccaccggattatttagatacc
agaatcacagccactttggagaaacagatctcagtggatgcagatggcaactttgatccc
aaacctatcaacactgtgaatttttccttgcctgaaaaattggaatacatcgtcaccaag
tatgctgagcattcacatgataaatgggcctgtgacaagagtcagagtggatggaaatac
gggatttccctggatgaaaatgtgaagacccacccactgataaggcctttcaagacatta
acggagaaggagaaggaaatttatcgctggcctgcccgagagtccctgaaaaccatgcta
gctgtgggctggactgtggagaggaccaaagagggagaagcgttggttcaacagcgggaa
aatgagaagcttcgaagcgtgtcccaggccaaccagggcaacagctacagccctgctccc
ctcgacctctcaaacgttgtactctccagggagctccagggaatggtggaggtcgtggct
gagaactatcacaatatctgggccaagaagaagaagctggagctggagagcaaaggtggt
ggcagtcaccctcttctggtaccatatgacaccttgactgccaaagaaaagttcaaggac
cgggagaaggcacaggacctgtttaagttcctccaagtgaatggcgtcatagtttccagg
ggtatgaaggatatggagcttgatgcctcctccatggaaaagaggtttgcctataagttc
ttgaagaagatcctgaaatacgttgattcggcacaagaatttattgcccatttagaagcc
attgtcagcagtgggaaaactgaaaagtctcctcatgaccaggagatcaaattctttgcc
aaagttctcctcccgctggttgaccagtacttcaccaatcatcgcctctacttcttgtca
tcccctctgaagccccttagcagcagtggatacgcctctcataaggagaaagaaatggtg
gccagcctgttctgcaaacttgctgcccttgttagacacagaatttccctctttggtagt
gattctactacaatggtgagctgtcttcacatcttagctcagacacttgacacaaggact
gtcatgaagtcgggctctgagctggtgaaggctgggctacgagcgttctttgaaaatggt
gcggaagacttggagaagacctcagaaaacctgaaacttgggaagttcacccattcccgg
acgcagattcaaggcgtttctcagaatgttaactacactacagtggccctgctccccatc
ctgacgtccatctttgagcacgtcgctcagcatcagtttggaatggatctactcttgggt
gatgtgcagatttcctgctaccacatactgtgcagcctctactcccttgggacaggaaag
aacatttatgttgaaaggcaacgccctgcccttggagaatgtctggcctcactggcagct
gccataccagtggcattcctggagcccaccctcaatcgctacaatcctctctcggtcttc
aacaccaaaacccccagggagaggtctattctggggatgccagacacggtggaagacatg
tgtcctgacatcccccagctggaaggcctgatgaaggaaatcaacgacctggccgagtca
ggggcgcggtacacagaggtgccgcatgtcatcgaggtgatcttacccatgctctgcaac
tacctgtcctactggtgggagcgggggcctgagaacctgccccccagcacagggcagtgc
tgcaccaaggtcacctctgaacacctcagtctcatcctgggcaacattctgaaaatcatc
aacaacaacctgggcatcgatgaagcctcctggatgaagcgcatcgcagtgtatgcgcag
cccatcatcagcaaagccaggcccgacctgctgagaagccacttcatcccaactctggag
aagctgaagaaaaaggctgtcaagaccgtgcaggaggaggagcagttgagagccgatggc
aaaggggacacccaggaggcggagctcctcatcctggacgaatttgcggtcctctgccga
gatctctatgccttctaccccatgctgatccgctacgtggacaacaacagatctaactgg
ctgaaaagccctgatgctgattctgaccagctcttccgcatggtggcagaagtcttcatc
ctgtggtgtaaatctcacaacttcaagagggaagagcaaaattttgtgattcagaatgaa
attaataatttggcatttttaactggagacagcaaaagcaagatgtcaaaagccatgcaa
gtaaagtctggaggacaagaccaggagcggaagaagacaaagcggcggggagacttgtat
tccatccagacctccctcatcgtggctgcactcaagaaaatgctgcccattggtttgaat
atgtgtactccaggcgaccaggagctgatctccctcgcaaaatcgcgatacggccatagg
gacacagatgaagaggtcagagaacatctgcggaacaacttgcacttgcaggaaaagtct
gatgacccagctgtaaaatggcagctgaacctctacaaggatgttctgaagagtgaagaa
cctttcaatccagaaaagacagtggagcgtgtgcagagaatttcagcagctgtcttccac
ctggaacaggtggaacagcctttgaggtccaagaaggccgtctggcacaaactgctgtca
aagcaacggaaacgggctgtggtggcctgcttcaggatggcccctctctacaacctgccc
aggcaccgctctattaacctcttcctccatggctatcagagattttggatagaaacagag
gagtattcctttgaagagaaactagtacaggatttggctaaatctccaaaggtggaagag
gaggaggaggaagagaccgaaaaacaacctgacccactgcatcagatcattctctatttt
agccgcaacgctctcacggagaggagcaaattggaagacgaccctttgtacacctcctat
tccagcatgatggctaagagttgtcaaagtggtgaggacgaagaagcagatgaagacaag
gaaaaaacattcgaagagaaggagatggagaagcagaaaaccctgtatcagcaagctcgg
ctgcatgagcgtggtgccgcggagatggtccttcagatgataagcgctagcaaaggtgag
atgagccccatggtggttgagactctgaagctggggatcgccattctgaacggaggcaat
gctggtgtgcaacagaaaatgctagattacctaaaggagaaaaaggatgctggattcttt
caaagcctttctggtcttatgcagtcttgcagtgtccttgatttgaatgcatttgagagg
cagaataaagctgaaggcctggggatggtgactgaagaaggaacactcattgttcgtgaa
cgtggtgaaaaagtactccagaatgacgagttcacgcgtgatctctttagattcctacag
ttactttgtgagggacataacagtgactttcagaacttcctgcggactcagatgggtaac
accaccaccgtgaatgtcatcatcagcactgtggactaccttctgcgtctgcaggaatca
atcagtgatttctactggtattattcggggaaggacatcattgatgaatccggacagcac
aatttctccaaagctctggcagtcaccaagcagattttcaattctcttacagaatacatc
cagggcccttgcattggtaatcagcagagcctggctcacagcaggctgtgggacgccgtg
gttggcttcctccatgtctttgctaatatgcagatgaaactgtctcaggattccagtcag
atcgagctgctgaaggaactcttggatctccttcaggacatggtggtgatgcttctgtcc
ctcctggaagggaatgtggtaaatggcaccattggcaagcagatggttgacacactggta
gaatcatctaccaatgtagaaatgatcttgaaattctttgacatgttcttgaaacttaaa
gacttaaccagctcagacaccttcaaagaatacgacccagatggtaaaggaattatctcc
aaaagagaattccagaaggccatggaagggcaaaaacagtacacgcagtcagagattgac
tttctcctttcgtgtgcagaagctgatgagaatgacatgtttaattacattgattttgta
gaccggttccatgagccggccaaggacatagggtttaatgtggctgtgttattgacaaat
ctttctgaacacatgccaaacgattcccggctgaagtgtctgttggacccagcagaaagt
gtgctaaattacttcgaaccctacctaggacgcatcgagatcatgggtggggccaagaaa
attgagcgtgtttattttgaaatcagtgagtccagtcgcactcagtgggagaagccccag
gtgaaggaatctaagcgacagttcatttttgatgttgtcaacgaaggtggggagcaggaa
aagatggagctgtttgtgaacttctgtgaggacaccatctttgaaatgcagttagcatct
cagatctctgaatccgattcagcggacaggccagaagaggaggaagaaggtgaagattct
tcttatgtgttagaaattgcgggtgaagaggaggaagacgggtctttcgagccggcctct
gcatttgcaatggcctgtgcctctgtgaagaggaacgtcgccgactttctgaagagagca
accctgaagaacctcaggaagcagtacaggaacgtgaaaaagatgactgcgaaggagctg
gtgaaggtgctctgctcctttttctggatgctgttcctggggctgttccagatgctcttc
accatactgggaggaatctttcagatcctctggagcacagtgttcggagggggcctggta
gaaggggcaaagaacatcagagtgaccaagatcctgggtgacatgcctgacccaacccaa
tttggtatccatgatgacactatggaggctgagagggcagaggtgatggagccaggtatc
accactgaactagtacacttcataaagggggagaagggagatacagatatcatgtcagac
ctctttggactccacccaaagaaagagggcagcttaaagcatgggcctgaagtgggtttg
ggtgacctctcagaaattattggcaaggatgaaccccctacgttagagagtactgtacag
aagaagaggaaagctcaggcagcagagatgaaagcagcaaatgaagcagaaggaaaagta
gaatccgagaaggcagacgtggaagatggagagaaggaagacaaagacaaagaagaggag
caagccgagtacctgtggacagaagtcacaaaaaagaagaagcggcgttgtggtcagaag
gctgagaagccggaagctttcacagccaatttctttaaagggctggacatctatcagacc
aagttactgcattacctggccaggaatttctacaacctgaggttccttgctctgtttgta
gccttcgctatcaacttcatcctgcttttttataaggtcactgaagaacctttagaagaa
gagacagaggatgttgcaaacctatggaattcatttaatgacgaggaagaggaagaagcg
atggtgttctttgtccttcaggagagcactgggtatatggcaccaacgctgcgggccctg
gccatcatccacaccatcatctctctagtctgtgtggtgggctactactgcctgaaggtg
cctttggtggtattcaaaagggaaaaagaaatcgccaggaagctggagtttgatggccta
tatatcaccgaacagccatctgaagatgacatcaaggggcagtgggaccgcttggtgatc
aacacaccatcttttcctaataactactgggacaagtttgtaaagagaaaggtgatcaac
aagtatggagatctctacggagcagagcgcattgctgaacttctgggtttggacaaaaat
gctcttgacttcagcccagtagaagagaccaaagcggaggcggcttctctggtgtcatgg
ctaagttccatagacatgaagtaccatatctggaagcttggagttgtgtttactgacaac
tcctttctgtaccttgcctggtatacaaccatgtcagtcctgggccactacaataacttc
ttctttgctgctcacctgctggatatcgcaatgggcttcaagacactgaggaccattctg
tcatctgtaactcacaatggcaaacagttggttctgacggtcggtctcctggccgtggtg
gtgtatctctatactgtggtggctttcaacttcttccgcaagttctacaacaaaagcgaa
gacgatgacgagcctgatatgaagtgtgacgacatgatgacgtgttaccttttccacatg
tacgtgggagtgagagcaggaggtggcattggtgacgagattgaagaccctgctggtgat
ccttatgaaatgtatcgcattgtctttgacattacctttttcttctttgtcattgtcatc
ttgctggccatcattcaaggtcttattattgatgctttcggagagctaagagaccagcag
gaacaagtgcgagaagatatggagaccaaatgtttcatctgtgggattggcaatgactac
tttgacacgacccctcatggttttgaaacacataccttacaagagcacaacttagccaac
tacttgttctttctgatgtatttgattaataaagatgaaacagagcacacgggtcaggaa
tcttatgtctggaagatgtaccaagaaaggtgctgggatttcttcccagctggtgactgc
tttcgtaaacagtatgaagatcagcttggataa

KEGG   Macaca mulatta (rhesus monkey): 717179
Entry
717179            CDS       T01028                                 

Gene name
RYR2
Definition
(RefSeq) ryanodine receptor 2 isoform X1
  KO
K04962  ryanodine receptor 2
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04020  Calcium signaling pathway
mcc04024  cAMP signaling pathway
mcc04260  Cardiac muscle contraction
mcc04261  Adrenergic signaling in cardiomyocytes
mcc04371  Apelin signaling pathway
mcc04713  Circadian entrainment
mcc04911  Insulin secretion
mcc04921  Oxytocin signaling pathway
mcc04972  Pancreatic secretion
mcc05020  Prion disease
mcc05022  Pathways of neurodegeneration - multiple diseases
mcc05410  Hypertrophic cardiomyopathy
mcc05412  Arrhythmogenic right ventricular cardiomyopathy
mcc05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    717179 (RYR2)
   04020 Calcium signaling pathway
    717179 (RYR2)
   04024 cAMP signaling pathway
    717179 (RYR2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    717179 (RYR2)
   04921 Oxytocin signaling pathway
    717179 (RYR2)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    717179 (RYR2)
   04261 Adrenergic signaling in cardiomyocytes
    717179 (RYR2)
  09154 Digestive system
   04972 Pancreatic secretion
    717179 (RYR2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    717179 (RYR2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    717179 (RYR2)
   05022 Pathways of neurodegeneration - multiple diseases
    717179 (RYR2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    717179 (RYR2)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    717179 (RYR2)
   05414 Dilated cardiomyopathy
    717179 (RYR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mcc04040]
    717179 (RYR2)
   04990 Domain-containing proteins not elsewhere classified [BR:mcc04990]
    717179 (RYR2)
Ion channels [BR:mcc04040]
 Voltage-gated cation channels
  Ryanodine receptor
   717179 (RYR2)
Domain-containing proteins not elsewhere classified [BR:mcc04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   717179 (RYR2)
SSDB
Motif
Pfam: RYDR_ITPR RyR RR_TM4-6 SPRY Ins145_P3_rec MIR RIH_assoc Ion_trans EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8
Other DBs
NCBI-GeneID: 717179
NCBI-ProteinID: XP_014982093
Ensembl: ENSMMUG00000001060
LinkDB
Position
1
AA seq 5028 aa
MADGGEGEDEIQFLRTDDEVVLQCTATIHKEQQKLCLAAEGFGNRLCFLESTSNSKNVPP
DLSICTFVLEQSLSVRALQEMLANTVEKSEGQVDVEKWKFMMKTAQGGGHRTLLYGHAIL
LRHSYSGMYLCCLSTSRSSTDKLAFDVGLQEDTTGEACWWTIHPASKQRSEGEKVRVGDD
LILVSVSSERYLHLSYGNGSLHVDAAFQQTLWSVAPISSGSEAAQGYLIGGDVLRLLHGH
MDECLTVPSGEHGEEQRRTVHYEGGAVSVHARSLWRLETLRVAWSGSHIRWGQPFRLRHV
TTGKYLSLMEDKNLLLMDKEKADVKSTAFTFRSSKEKLDVGVRKEVDGMGTSEIKYGDSV
CYIQHVDTGLWLTYQSVDVKSVRMGSIQRKAIMHHEGHMDDGISLSRSQHEESRTARVIR
STVFLFNRFIRGLDALSKKAKATTVDLPIESVSLSLQDLIGYFHPPDEHLEHEDKQNRLR
ALKNRQNLFQEEGMINLVLECIDRLHVYSSAAHFADVAGREAGESWKSILNSLYELLAAL
IRGNRKNCAQFSGSLDWLISRLERLEASSGILEVLHCVLVESPEALNIIKEGHIKSIISL
LDKHGRNHKVLDVLCSLCVCHGVAVRSNQHLICDNLLPGRDLLLQTRLVNHVSSMRPNIF
LGVSEGSAQYKKWYYELMVDHTEPFVTAEATHLRVGWASTEGYSPYPGGGEEWGGNGVGD
DLFSYGFDGLHLWSGCIARTVSSPNQHLLRTDDVISCCLDLSAPSISFRINGQPVQGMFE
NFNIDGLFFPVVSFSAGIKVRFLLGGRHGEFKFLPPPGYAPCYEAVLPKEKLKVEHSREY
KQERTYTRDLLGPTVSLTQAAFTPIPVDTSQIVLPPHLERIREKLAENIHELWVMNKIEL
GWQYGPVRDDNKRQHPCLVEFSKLPEQERNYNLQMSLETLKTLLALGCHVGISDEHAEDK
VKKMKLPKNYQLTSGYKPAPMDLSFIKLTPSQEAMVDKLAENAHNVWARDRIRQGWTYGI
QQDVKNRRNPRLVPYTLLDDRTKKSNKDSLREAVRTLLGYGYNLEAPDQDHAARAEVCSG
TGERFRIFRAEKTYAVKAGRWYFEFETVTAGDMRVGWSRPGCQPDQELGSDERAFAFDGF
KAQRWHQGNEHYGRSWQAGDVVGCMVDMNEHTMMFTLNGEILLDDSGSELAFKDFDVGDG
FIPVCSLGVAQVGRMNFGKDVSTLKYFTICGLQEGYEPFAVNTNRDITMWLSKRLPQFLQ
VPSNHEHIEVTRIDGTIDSSPCLKVTQKSFGSQNSHTDIMFYRLSMPIECAEVFSKTVAG
GLPGAGLFGPKNDLEDYDADSDFEVLMKTAHGHLVPDRVDKDKEATKPEFNNHKDYAQEK
PSRLKQRFLLRRTKPDYSTSHSARLTEDVLADDRDDYDFLMQTSTYYYSVRIFPGQEPAN
VWVGWITSDFHQYDTGFDLDRVRTVTVTLGDEKGKVHESFAIDSLCGFGIKRSNCYMVCA
GESMSPGQGRNNNGLEIGCVVDAASGLLTFIANGKELSTYYQVEPSTKLFPAVFAQATSP
NVFQFELGRIKNVMPLSAGLFKSEHKNPVPQCPPRLHVQFLSHVLWSRMPNQFLKVDVSR
ISERQGWLVQCLDPLQFMSLHIPEENRSVDILELTEQEELLKFHYHTLRLYSAVCALGNH
RVAHALCSHVDEPQLLYAIENKYMPGLLRAGYYDLLIDIHLSSYATARLMMNNEYIVPMT
EETKSITLFPDENKKHGLPGIGLSTSLRPRMQFSSPSFVSVSNECYQYSPEFPLDILKAK
TIQMLTEAVKEGSLHARDPVGGTTEFLFVPLIKLFYTLLIMGIFHNEDLKHILQLIEPSV
FKEAATPEEESDTLEKELSVDDAKLQGAGEEEAKGGKRPKEGLLQMKLPEPVKLQMCLLL
QYLCDCQVRHRIEAIVAFSDDFVAKLQDNQRFRYNEVMQALNMSAALTARKTKEFRSPPQ
EQINMLLNFKDDKSECPCPEEIRDQLLDFHEDLMTHCGIELDEDGSLDGNSDLTIRGRLL
SLVEKVTYLKKKQAEKPVESDSKKSSTLQQLISETMVRWAQESVIEDPELVRAMFVLLHR
QYDGIGGLVRALPKTYTINGVSVEDTINLLASLGQIRSLLSVRMGKEEEKLMIRGLGDIM
NNKVFYQHPNLMRALGMHETVMEVMVNVLGGGESKEITFPKMVANCCRFLCYFCRISRQN
QKAMFDHLSYLLENSSVGLASPAMRGSTPLDVAAASVMDNNELALALREPDLEKVVRYLA
GCGLQSCQLLVSKGYPDIGWNPVEGERYLDFLRFAVFCNGESVEENANVVVRLLIRRPEC
FGPALRGEGGNGLLAAMEEAIKIAEDPSRDGPSPNSGSSKTLDTEEEEDDTIHMGNAIMT
FYAALIDLLGRCAPEMHLIHAGKGEAIRIRSILRSLIPLGDLVGVISIAFQMPTIAKDGN
VVEPDMSAGFCPDHKAAMVLFLDRVYGIEVQDFLLHLLEVGFLPDLRAAASLDTAALSAT
DMALALNRYLCTAVLPLLTRCAPLFAGTEHHASLIDSLLHTVYRLSKGCSLTKAQRDSIE
VCLLSICGQLRPSMMQHLLRRLVFDVPLLNEHAKMPLKLLTNHYERCWKYYCLPGGWGNF
GAASEEELHLSRKLFWGIFDALSQKKYEQELFKLALPCLSAVAGALPPDYMESNYVSMME
KQSSMDSEGNFNPQPVDTSNITIPEKLEYFINKYAEHSHDKWSMDKLANGWIYGEIYSDS
SKVQPLMKPYKLLSEKEKEIYRWPIKESLKTMLAWGWRIERTREGDSMALYNRTRRISQT
SQVSVDAAHGYSPRAIDMSNVTLSRDLHAMAEMMAENYHNIWAKKKKMELESKGGGNHPL
LVPYDTLTAKEKAKDREKAQDILKFLQINGYAVSRGFKDLELDTPSIEKRFAYSFLQQLI
RYVDEAHQYILEFDPDFLQCFSLYLKLRSFNFRSHQEAICIIRGQDGGSRGKGEHFPYEQ
EIKFFAKVVLPLIDQYFKNHRLYFLSAASRPLCSGGHASNKEKEMVTSLFCKLGVLVRHR
ISLFGNDATSIVNCLHILGQTLDARTVMKTGLESVKSALRAFLDNAAEDLEKTMENLKQG
QFTHTRNQPKGVTQIINYTTVALLPMLSSLFEHIGQHQFGEDLILEDVQVSCYRILTSLY
ALGTSKSIYVERQRSALGECLAAFAGAFPVAFLETHLDKHNIYSIYNTKSSRERAALSLP
TNVEDVCPNIPSLEKLMEEIVELAESGIRYTQMPHVMEVILPMLCSYMSRWWEHGPENNP
ERAEMCCTALNSEHMNTLLGNILKIIYNNLGIDEGAWMKRLAVFSQPIINKVKPQLLKTH
FLPLMEKLKKKAAMVVSEEDHLKAEARGDMSEAELLILDEFTTLARDLYAFYPLLIRFVD
YNRAKWLKEPNPEAEELFRMVAEVFIYWSKSHNFKREEQNFVVQNEINNMSFLITDTKSK
MSKAAVSDQERKKMKRKGDRYSMQTSLIVAALKRLLPIGLNICAPGDQELIALAKNRFSL
KDTEDEVRDIIRSNIHLQGKLEDPAIRWQMALYKDLPNRTDDTSDPEKTVERVLDIANVL
FHLEQKSKRVGRRHYCLVEHPQRSKKAVWHKLLSKQRKRAVVACFRMAPLYNLPRHRAVN
LFLQGYEKSWIETEEHYFEDKLIEDLAKPGADPPEEDEGTKRVDPLHQLILLFSRTALTE
KCKLEEDFLYMAYADIMAKSCHDEEDDDGEEEVKSFEVTGSQRSKEKEMEKQKLLYQQAR
LHDRGAAEMVLQTISASKGETGPMVAATLKLGIAILNGGNSTVQQKMLDYLKEKKDVGFF
QSLAGLMQSCSVLDLNAFERQNKAEGLGMVTEEGSASHFESHRLRTGEKVLQDDEFTCDL
FRFLQLLCEGHNSDFQNYLRTQTGNNTTVNIIISTVDYLLRVQESISDFYWYYSGKDVID
EQGQRNFSKAIQVAKQVFNTLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMQMKLS
QDSSQIELLKELMDLQKDMVVMLLSMLEGNVVNGTIGKQMVDMLVESSNNVEMILKFFDM
FLKLKDLTSSDTFKEYDPDGKGVISKRDFHKAMESHKHYTQSETEFLLSCAETDENETLD
YEEFVKRFHEPAKDIGFNVAVLLTNLSEHMPNDTRLQTFLELAESVLNYFQPFLGRIEIM
GSAKRIERVYFEISESSRTQWEKPQVKESKRQFIFDVVNEGGEKEKMELFVNFCEDTIFE
MQLAAQISESDLNERSANKEESEKERPEEQGPRMAFFSILTVKSALFALRYNILTLMRML
SLKSLKKQMKKVKKMTVKDMVTAFFSSYWSIFMTLLHFVASVFRGFFRIICSLLLGGSLV
EGAKKIKVAELLANMPDPTQDEVRGDGEEGERKTLEAALPSEDLTDLKELTEESDLLSDI
FGLDLKREGGQYKLIPHNPNAGLSDLMSNPVPMPEVQEKFQEQKAKEEEKEEKEETKSEP
EKAEGEDGEKEEKAKEDKGKQKLRQLHTHRYGEPEVPESAFWKKIIAYQQKLLNYFARNF
YNMRMLALFVAFAINFILLFYKVSTSSVVEGKELPTRSSSENAKVTSLDSSSHRIIAVHY
VLEESSGYMEPTLRILAILHTVISFFCIIGYYCLKVPLVIFKREKEVARKLEFDGLYITE
QPSEDDIKGQWDRLVINTQSFPNNYWDKFVKRKVMDKYGEFYGRDRISELLGMDKAALDF
SDAREKKKPKKDSSLSAVLNSIDVKYQMWKLGVVFTDNSFLYLAWYMTMSVLGHYNNFFF
AAHLLDIAMGFKTLRTILSSVTHNGKQLVLTVGLLAVVVYLYTVVAFNFFRKFYNKSEDG
DTPDMKCDDMLTCYMFHMYVGVRAGGGIGDEIEDPAGDEYEIYRIIFDITFFFFVIVILL
AIIQGLIIDAFGELRDQQEQVKEDMETKCFICGIGNDYFDTVPHGFETHTLQEHNLANYL
FFLMYLINKDETEHTGQESYVWKMYQERCWEFFPAGDCFRKQYEDQLN
NT seq 15087 nt   +upstreamnt  +downstreamnt
atggccgatgggggcgagggcgaagacgagatccagttcctgcgaactgatgatgaagtg
gttctgcagtgcaccgcaaccatccacaaagaacaacagaaactatgcttggcagcagaa
ggatttggcaacagactttgtttcttggagtccacttctaattccaagaatgtgccccca
gacctctccatctgcacctttgtgctggagcagtccctctctgtccgggccctgcaggag
atgctggctaacaccgtggagaaatcagaagggcaagttgatgtggaaaaatggaaattc
atgatgaagactgctcaaggtggtggtcatcgaacactcctctatggacatgccatattg
ctgcgccattcctacagtggcatgtatctgtgctgcctgtccacctcccggtcttcaact
gataagctggcttttgatgttggcttgcaagaggacaccacaggagaggcttgttggtgg
accatacaccctgcctctaagcagcgatcagaaggagaaaaagtacgagttggagatgac
ctcatcttagttagcgtgtcctctgaaaggtacttgcacttgtcttacggcaacggcagc
ttacatgtggatgccgctttccagcagactctctggagcgtggccccaatcagctcagga
agtgaggcagcccaagggtatctcattggtggtgatgtcctcaggttgctgcatggacac
atggacgagtgtctcactgtcccttcaggagaacatggtgaagagcagcggagaactgtt
cattacgaaggtggcgctgtgtctgttcatgcacgttccctttggagactagagacacta
agagttgcgtggagtggaagccacataagatggggccagccgttccgactacgccatgtc
acaacaggaaaatacttgagtctcatggaagacaaaaaccttctactcatggacaaagag
aaagctgatgtaaaatcaacagcatttaccttccggtcttccaaggaaaaattggatgta
ggggtgagaaaagaagtcgatggcatgggaacatctgaaataaaatacggtgactcagta
tgctatatacaacatgtggacacgggcctatggcttacttaccagtctgtggatgtgaaa
tctgtgagaatgggatctatacaacgtaaggctattatgcaccatgaaggccacatggat
gatggcataagtttatcgagatcccagcatgaagaatcacgcacagcacgagttatccgg
agcacagtcttccttttcaatagatttataaggggcctcgatgcgctcagcaagaaagcg
aaggctaccaccgtcgatttgccgatagaatccgtgagtctaagtctgcaggatctcatt
ggctactttcacccgcccgatgagcatttagaacatgaagacaaacagaacagactacga
gccctgaagaatcggcaaaatctcttccaggaagagggaatgatcaacctcgtgctcgag
tgcatagaccgactgcacgtctacagcagtgcagcacactttgctgatgttgctgggcga
gaagcgggggagtcttggaaatccattctgaattctctgtatgagttgctggcggctcta
attagaggaaatcgtaaaaactgtgcacagttttccggctcccttgactggttgatcagc
agattggaaagactggaagcttcttcgggcattctggaagttttacactgtgttttagta
gaaagtccagaagctctaaatattattaaagaaggacatattaaatccattatctcactt
ttagacaagcatggaagaaatcacaaggtcctggacgtgttgtgctcactctgtgtttgc
catggggttgcagtccgttctaaccagcacctcatctgtgacaatctcttaccaggaaga
gatctgttattgcagacacgtcttgtgaaccacgtcagcagcatgagacccaatattttt
ctgggcgtcagtgaaggttctgctcagtataagaaatggtactatgaattgatggtggac
cacacagagccctttgtgacagctgaagcaacgcacctgcgagtgggctgggcttccact
gaagggtattctccctaccctggagggggcgaagagtggggtggaaatggtgttggagat
gatctcttctcctatggatttgatggccttcatctctggtcaggttgtattgctcgtact
gtaagctcaccaaaccaacatctgttaagaactgatgatgtcatcagttgctgtttagat
ctaagtgccccaagcatctcgttccgaattaatggacaacctgttcaaggaatgtttgag
aatttcaacatcgatggcctcttctttccagtcgttagtttctctgcgggaataaaagta
cgctttctgcttggggggcgacatggagaattcaaatttcttcctccacccgggtacgct
ccttgttatgaagctgttctgccaaaagaaaagttgaaagtggaacacagccgagagtac
aagcaagaaagaacttacacacgcgacctgctgggccccacggtttccctgacacaagct
gccttcacaccgatccctgtggataccagccagattgtgttgcctcctcatctagaaaga
ataagagaaaaactggcagagaatatccatgaactctgggttatgaataaaattgagctt
ggctggcagtatggaccggttagagatgacaacaagagacagcacccatgcctggtggag
ttctccaagctgcctgaacaggagcgcaattacaacttacaaatgtcgcttgagaccctg
aagactttgttggcattaggatgtcatgtgggtatatcagatgaacatgctgaagacaag
gtgaaaaaaatgaagctacccaagaattaccagctgacaagtggatacaagcccgcccct
atggacctgagctttatcaaactcaccccgtctcaagaagcaatggtggacaagttggca
gaaaatgcacacaatgtgtgggcgcgggatcgaatccggcagggctggacttacggcatc
cagcaggacgtaaagaacagaagaaatcctcgccttgttccctacactcttctggatgac
cgaaccaagaaatccaacaaggacagcctccgcgaggccgtgcgcacgctgctggggtac
ggttacaacttggaagcaccagatcaagaccatgcagccagagccgaagtgtgcagcggc
actggggaaaggttccgaatcttccgtgccgagaagacttacgcagtgaaggcgggacgg
tggtattttgaatttgagacggtcactgctggagacatgagagttggttggagtcggcct
ggttgtcaaccggatcaggagctcggctcggatgaacgtgcctttgcctttgatggcttc
aaggcccagcggtggcatcagggcaacgaacactatgggcgctcttggcaagcaggcgat
gtcgtgggctgtatggttgacatgaacgaacacaccatgatgttcacactgaacggtgaa
atccttcttgatgattcaggttcagaactggctttcaaggactttgatgttggcgacgga
ttcatacctgtgtgtagccttggagtggctcaagtgggcaggatgaactttggaaaggat
gtcagcaccttgaaatacttcaccatctgtggcttacaagagggctatgaaccatttgcc
gttaatacaaacagggatattactatgtggctgagcaagaggcttcctcagtttctccaa
gttccatcaaaccatgaacatatagaggtgaccagaatagacggcaccatagacagttcc
ccatgtttaaaggtcactcagaagtcttttggttctcagaacagccacactgatatcatg
ttctatcgcctgagcatgccgatcgagtgcgcggaggtcttctccaagactgtggctgga
gggctccctggggctggcctttttgggcccaagaatgatttggaagattatgatgctgat
tctgactttgaggttctgatgaagacagctcatggccatctagtgcccgatcgtgttgac
aaagacaaagaagctaccaagccagagtttaataaccacaaagattatgcccaggaaaag
ccctctcgtctgaaacaaagatttttgcttagaagaacaaagccagattacagcacgagc
cattctgcaagactcaccgaagatgtccttgctgatgatcgggatgattatgatttcttg
atgcaaacgtccacgtactattactcagtgagaatcttccctggacaagaacctgctaat
gtctgggtgggctggattacatcggatttccatcagtatgacacaggctttgacttggac
agagttcgcacagtaacagttactctaggagatgaaaaaggaaaagtgcatgaaagcttt
gccattgactcgctgtgtggctttggcatcaaacgcagcaactgctatatggtatgtgcg
ggtgagagcatgagccccgggcaaggacgcaacaataatggactggagatcggctgtgtg
gtggatgctgccagcgggctgctcacgttcattgccaatggcaaggaactgagcacatac
tatcaggtggagccgagtacaaaattatttcctgcggtttttgcacaagctacaagtccc
aatgttttccagtttgagttgggaagaataaagaatgtgatgcctctctcggcgggatta
ttcaagagtgagcacaagaaccccgtgccgcagtgtcccccgcgcctccacgtgcagttc
ctgtcacacgtgctgtggagcagaatgcccaaccagtttttgaaggtagatgtgtctcga
ataagtgaacgccaaggctggttggtgcagtgtttggatcccctgcagttcatgtctctt
catatccctgaggaaaacagatctgttgacatcttggagttgacagagcaggaggagttg
ctgaaatttcactatcacactctgcggctctactcagctgtctgtgctcttgggaaccac
cgggtggcccacgccctgtgcagccacgtggatgaacctcagctcctctacgccattgag
aacaagtacatgcctggcttgctgcgtgctggctactatgacctgctgatcgacatccac
ctgagctcctatgccactgccaggctcatgatgaacaacgagtacattgtccccatgacg
gaggagacgaagagcatcaccctgttccccgatgagaacaaaaagcatggccttccaggg
atcggcctcagcacctctctcaggccacggatgcagttttcctcccccagttttgtaagt
gttagtaatgaatgttaccagtatagtccagagttcccactggacatcctcaaggccaag
accatacagatgctgacggaagctgttaaagagggcagtcttcatgcccgggacccagtt
ggagggactactgaattcctctttgtgcctctcatcaagcttttctataccctgctaatc
atgggcatcttccacaacgaggacttgaagcacatcttgcagcttatcgagcccagtgtg
tttaaagaagcggccactccagaggaggagagtgatacactggagaaagagctcagtgtg
gatgacgcaaagctgcaaggagctggtgaggaagaagccaaggggggcaagcggcccaag
gaaggcctgctccaaatgaaactgccagagccagttaaattgcagatgtgcctactgctt
caatacctctgtgactgccaggtccggcaccggatagaagccattgtagccttttcagat
gattttgtagctaagctccaagacaatcaacgtttccgatacaacgaagttatgcaagcc
ttaaacatgtcagctgcactcacagccaggaaaacaaaggaattcagatcaccacctcaa
gagcagatcaatatgcttctcaattttaaggatgacaaaagtgaatgtccgtgtccagaa
gaaattcgtgaccaactattggatttccatgaagatttgatgacgcattgtggaattgag
ctggatgaagatgggtctctggatggaaacagtgatttaacaattagagggcgtctgcta
tccctggtagaaaaggtgacatacctgaagaagaagcaagcagaaaaaccagttgagagt
gactccaaaaagtcctccactctgcagcagctgatctctgagaccatggtcagatgggct
caggagtctgtcattgaagaccccgagctggtgagggccatgtttgtgttgctccatcgg
cagtatgatggcattgggggtcttgttcgggccctgccaaagacctacacgataaatggt
gtgtccgtggaggacaccatcaacctgctggcgtcccttggtcagattcggtccctgctg
agtgtgagaatgggcaaagaagaggagaagcttatgattcgcggattaggggatattatg
aataacaaggtgttttaccagcaccctaatctcatgagggcactggggatgcatgagact
gtgatggaggtcatggtgaacgtccttggaggtggagagtccaaggaaatcacctttccc
aagatggtggccaactgttgccgttttctctgttacttctgtcgtataagtaggcagaat
caaaaagctatgtttgatcatctcagttatttactggaaaacagcagtgttggtcttgcc
tccccagctatgagaggttcaacaccactggatgtggctgcagcttcggtgatggataat
aatgaactagcattagctctgcgtgagccggatctagaaaaggtagttcgttacttggct
ggttgtggactgcagagttgccagttgctggtgtctaagggttacccagacattgggtgg
aatccagttgaaggagagagataccttgactttctcagatttgctgtcttctgtaatggg
gagagtgtggaggagaatgcaaatgtcgtggtgagattgcttattcggaggcctgagtgt
tttggtcctgctttgagaggagaaggtgggaatgggcttcttgcagcaatggaagaagcc
atcaaaatcgccgaggatccttctcgagatggtccctcaccaaatagcggatccagtaaa
acacttgatacagaggaggaggaagatgacactatccacatggggaacgcgatcatgacc
ttctatgcagctttgattgacctcttgggacgctgtgcgcctgagatgcatttgattcat
gctggtaagggagaagccatcagaattaggtctattttgagatccctaattcccttggga
gatttggtgggcgttatcagcatcgcttttcagatgccaacaatagccaaagatgggaat
gtggtggaacctgacatgtctgcggggttttgcccagatcacaaggcagccatggtttta
ttccttgacagggtctatggaattgaggttcaagacttcctcctccatcttcttgaggtt
ggctttctgccagatctccgggcggctgcttctttagatacggcggctttgagtgctaca
gacatggccttggccctcaatcggtacctttgcacggccgtcttgccgttgctaacaaga
tgtgctcctctctttgctggcacagagcaccatgcttctctcattgactcattgcttcat
actgtgtatagactttctaagggctgttcacttaccaaagctcagcgggattctatagaa
gtttgtttgctctctatttgtggacaactgagaccttctatgatgcagcacttactcaga
agattagtatttgatgttccattattaaatgaacatgcaaagatgcctctgaaactgctg
acaaatcattatgaaagatgctggaaatattactgcctgcctggagggtggggaaacttt
ggtgctgcctcagaagaagaacttcatttatcaagaaagttgttctggggcatttttgat
gccctgtctcaaaagaaatatgaacaagagcttttcaaactggcactgccttgcctgagt
gcagttgcgggagctttgcctccagactacatggagtcaaattatgtcagtatgatggaa
aaacagtcatcaatggattctgaagggaactttaacccacaacctgttgatacctcaaat
attacaattcctgagaagttggaatacttcattaacaaatatgcagaacactcgcatgac
aaatggtcaatggacaagttggcaaatggatggatttatggagaaatatattcagactct
tctaaggttcaaccattaatgaagccatacaagctattgtctgaaaaggaaaaagaaatt
tatcgctggccaatcaaagaatctttaaaaactatgctggcttggggctggagaattgaa
agaactcgagagggagacagcatggccctttacaaccggactcgtcgtatttctcagaca
agccaggtttctgtagacgctgcccatggttacagtccccgggccattgacatgagcaat
gttacgctatctagagacctgcatgctatggcagaaatgatggctgaaaactaccataat
atatgggcaaagaaaaagaaaatggagttggagtccaaaggaggaggtaaccaccctctg
ctggtgccctatgatacactgacagccaaagagaaagccaaggatagagaaaaagcacag
gacatcctcaagttcttgcagatcaatggatatgctgtatccagaggatttaaggacctg
gaactggacacgccttctattgagaaacgatttgcctacagtttcctccaacaactcatt
cgctatgtggatgaagcccatcagtatatcctggagtttgatcctgacttcctgcagtgt
tttagtttgtatcttaaattgagaagctttaactttcggtcacaccaagaggcaatctgt
attattagaggccaggatggtggcagcagaggcaaaggagaacatttcccttatgaacaa
gaaatcaagttctttgcaaaagtcgttcttcctttaattgatcagtatttcaaaaaccat
cgtttatacttcttatctgcagcaagcagacctctctgctctggaggacatgcttccaac
aaagagaaagaaatggtgactagcctattctgcaaacttggagttcttgtcaggcatagg
atttcactatttggcaatgatgcaacatcaattgtcaactgtcttcatattttgggtcag
actttggatgcaaggacagtgatgaagactggcctggagagtgttaaaagtgcactcaga
gcttttctggacaatgccgcagaggatctggagaagaccatggaaaacctcaagcagggc
cagttcactcacacccgaaaccagcccaaaggggttactcagattatcaattacaccaca
gtggccctgcttccaatgctgtcgtcattatttgaacatattggccagcatcagttcgga
gaagacctcatattggaagatgtccaggtgtcttgttatagaattctgactagcttatat
gctttgggaaccagcaagagtatttatgtggagaggcaacgttctgcattaggagaatgt
cttgctgcgtttgctggtgcctttcctgtagcatttttggaaactcatctggacaaacat
aatatttactccatctacaataccaagtcttcacgagaaagagcagctctcagtttgcca
actaatgtggaagatgtttgtccaaatataccgtctttggagaaactcatggaagaaatc
gtggaattagctgagtccggcattcgctacactcaaatgccacatgtgatggaagtcata
ctgcccatgctttgcagctacatgtctcgttggtgggagcatgggcctgagaacaatcca
gaacgggccgagatgtgctgcacagccctgaactcagagcacatgaacacacttctaggg
aacatattgaaaatcatatataataacttggggattgatgagggagcctggatgaagagg
ctagcagtgttttcccagcctataataaataaagtgaaacctcagctcttgaaaactcat
ttcttgccgttaatggagaaactcaagaaaaaggcagccatggtggtgtctgaggaagat
cacctgaaagccgaggccaggggggacatgtcagaggctgaactcctcatcctagatgag
ttcaccacgctggccagagatctctatgccttctaccctctcttgattagatttgtggac
tataacagggcaaagtggctgaaggagcctaacccggaagcagaggagctcttccgcatg
gtggcagaagtgtttatctactggtcgaaatcccataatttcaaaagagaagagcagaac
ttcgttgtacagaatgaaatcaacaatatgtctttccttattactgataccaagtccaag
atgtccaaggcagcggtttctgatcaggaaaggaagaaaatgaagcgcaaaggagatcgg
tattccatgcagacctctctgattgtagcagctctgaagcgcttactgcccattgggttg
aacatctgtgccccaggggaccaggagctcattgctctagccaaaaatcgatttagcctg
aaagatactgaggatgaagtacgagatataatccgcagcaatattcatttacaaggcaag
ttggaggatcctgctattagatggcaaatggctctttacaaagacttgccaaacaggact
gatgatacctcagatccagagaagacggtagaaagagtattggatatagcaaatgtgctt
tttcatcttgaacagaagtctaaacgtgtgggtcggagacattactgtctggtggaacat
cctcagagatctaaaaaggctgtatggcataaactactctccaagcagaggaaaagagct
gttgtcgcctgcttccggatggcccccttatataatctgccaaggcatcgggctgtcaat
ctctttcttcagggatatgaaaagtcttggattgaaacagaagaacattactttgaagat
aaactgatagaagatttagcaaaacctggggctgaccctccagaagaagatgaaggcact
aagagagttgatcctctacatcagctgatccttctgtttagtcggacagctttaacagag
aaatgcaaactggaggaagattttttatatatggcctatgcagatattatggcaaagagt
tgtcatgatgaggaagatgatgacggggaagaggaagtgaagagttttgaagtcacagga
tcccaacgcagcaaggaaaaagaaatggaaaagcaaaagcttctataccagcaagcgcga
ctccacgaccgtggtgcggctgagatggtgctgcagaccatcagtgccagcaaaggtgaa
actggaccaatggtagcagctactttgaaacttggaattgctattttaaatggtgggaac
tccacagtacagcagaaaatgcttgactacctcaaggagaaaaaggatgtgggcttcttt
cagagcctggccggcctgatgcagtcatgtagtgtccttgacctaaatgcatttgagcga
caaaacaaagctgaaggtcttgggatggtgacagaggaaggatcagcctctcactttgaa
agtcacagactgcggactggagaaaaggttctacaggacgatgagttcacctgtgacctc
ttccgattcctgcagctactctgtgagggacacaactcagattttcagaattatctgaga
actcagactggcaataatacaactgtcaacataatcatctccactgtagactacctactg
agagttcaggaatcaattagtgacttttactggtattactctgggaaagatgttattgat
gaacaaggacaacggaatttctccaaagctattcaagtggcaaaacaagtctttaacact
cttacagagtatattcagggtccttgcactgggaatcaacagagtttggcacacagcagg
ctgtgggatgctgtggtcggctttcttcatgtatttgcccacatgcagatgaagctgtcg
caggattccagtcagattgagcttttaaaagaattaatggatctgcagaaggatatggtg
gtcatgttgctgtccatgctagaaggtaatgttgttaacggaacgattggcaaacagatg
gtggatatgcttgtggaatcttccaacaatgtggagatgattctcaaattttttgacatg
ttcttaaaactgaaagatttgacgtcgtctgatacttttaaagaatatgaccccgatggc
aagggagtcatttccaagagggacttccacaaagcgatggagagtcataagcactacacg
cagtcagaaacggaatttcttttgtcttgtgcggagacggatgagaatgaaacccttgac
tatgaggagttcgtcaaacgcttccacgaacctgcaaaggacatcggcttcaatgtcgcc
gtccttctgacaaacctctctgagcacatgcccaacgatacccgacttcagactttccta
gaattagcagagagtgtcctgaattatttccagccctttctgggccgcatcgaaatcatg
ggaagcgccaaacgcatcgagagagtctattttgaaatcagtgagtctagccgaacccag
tgggagaagccccaggtcaaggagtccaaacgacagttcatatttgatgtggtcaatgaa
ggaggagaaaaagagaagatggaactctttgtgaacttctgcgaggacaccatctttgaa
atgcagctggcggctcagatctcagagtcggatttgaacgagaggtcagcgaataaggaa
gaaagtgagaaggagaggccggaagagcaggggccgagaatggctttcttctccattctg
acggtcaagtcggccctgtttgcgctcaggtacaatatcttgacccttatgcgaatgctc
agtctgaagagcctgaagaagcagatgaaaaaagtcaaaaagatgaccgtgaaggacatg
gtcacggccttcttttcatcctactggagtatttttatgaccctcttgcacttcgtggcc
agcgttttcagaggctttttccgcatcatttgcagcctgctgcttgggggaagcctcgtc
gaaggtgctaaaaagatcaaagttgcagaactcttagccaacatgccagaccccactcag
gatgaggttagaggagatggggaggagggagagaggaaaaccctggaagccgccctgccc
tctgaggatctgaccgacttaaaggagctgacagaagagagtgaccttctttcggacatc
ttcggcctggatctgaagagagaaggaggacagtacaaactaatccctcataatccaaat
gctgggctcagtgacctcatgagcaacccagtccccatgcctgaggtgcaagaaaaattt
caggaacagaaggcaaaagaagaagaaaaggaagaaaaagaagaaaccaaatctgaacct
gaaaaagccgagggagaagatggagaaaaagaagagaaagccaaggaagacaagggcaaa
caaaagttgaggcagcttcacacacacagatacggagaaccggaagtgcccgagtcagcg
ttctggaagaaaatcatagcataccaacagaaacttctaaactattttgctcgcaacttt
tacaacatgagaatgttagccttatttgttgcatttgctatcaatttcatcttgctcttt
tataaggtctccacttcttctgtggttgaaggaaaggagctccccactagaagttcaagt
gaaaatgccaaagtgaccagcctggacagcagctcccatagaatcatcgcagttcactat
gtactggaggagagcagtggctacatggagcccacgttgcgtatcttagctattctccac
acggtcatttccttcttctgcatcattggatactactgcttgaaagtcccattggttatt
tttaagcgagaaaaggaagtagcacggaaattggaatttgatgggctttatattacagaa
cagccttcagaagatgatattaaaggccagtgggatagactcgtaatcaacacacagtca
tttcccaacaactactgggacaaatttgttaaaagaaaggtaatggataagtacggagag
ttctacggccgagacagaattagtgaattacttggcatggacaaggcagctctggacttc
agtgatgccagagaaaagaagaagccaaagaaagacagctccttatcagctgtactgaac
tctattgatgtgaagtatcagatgtggaaactaggagtggttttcactgacaactccttc
ctctacctagcctggtatatgactatgtctgttcttggacactataacaacttttttttt
gctgctcaccttctcgacattgctatgggattcaagacattaagaaccatcttgtcctca
gtaactcacaatggcaaacagctcgtattaactgttggcttgttagctgttgttgtgtac
ctgtacaccgtggtggcattcaattttttccgaaaattctacaataaaagtgaagacggt
gatacaccagatatgaaatgtgatgatatgctaacgtgctatatgttccacatgtatgtt
ggagttcgtgccggaggagggatcggggatgaaatcgaagacccagcaggagatgaatat
gagatctatcgaatcatctttgacatcactttcttcttctttgttattgtcattctcttg
gccataatacaaggtctaattatcgatgcttttggagaactaagagaccaacaggaacaa
gtcaaagaagacatggagaccaaatgcttcatctgtgggataggcaatgattacttcgac
acagtgccacatggctttgaaacccacactttacaggagcacaacttggctaattacttg
ttttttctgatgtatcttataaacaaagacgaaacagaacacacaggacaggaatcttat
gtctggaagatgtatcaagaaaggtgctgggaatttttcccagcaggggattgtttccgg
aaacagtatgaggaccagctaaattaa

DBGET integrated database retrieval system