KEGG   Macaca mulatta (rhesus monkey): 693700
Entry
693700            CDS       T01028                                 

Gene name
LYPLA1
Definition
(RefSeq) acyl-protein thioesterase 1
  KO
K06128  lysophospholipase I [EC:3.1.1.5]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00564  Glycerophospholipid metabolism
mcc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    693700 (LYPLA1)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    693700 (LYPLA1)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     693700 (LYPLA1)
SSDB
Motif
Pfam: Abhydrolase_2 Hydrolase_4 Abhydrolase_3 Abhydrolase_1 Abhydrolase_6 Cutinase Palm_thioest FSH1 DUF2974 DLH Esterase Esterase_PHB Lipase_3 DUF2920
Other DBs
NCBI-GeneID: 693700
NCBI-ProteinID: NP_001253217
Ensembl: ENSMMUG00000013157
UniProt: F6Z819
LinkDB
Position
8
AA seq 230 aa
MCGNNMSTPLPAIVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSSHIKYICPHAPVRP
VTLNMNMAMPSWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQ
GGALSLYTALTTQQKLAGVTALSCWLPLRASFPQGPVGGANRDISILQCHGDCDPLVPLM
FGSLTVEKLKTLVNPVNVTFKTYEGMMHSSCQQEMMDVKQFIDKLLPPID
NT seq 693 nt   +upstreamnt  +downstreamnt
atgtgcggcaataacatgtcaaccccgctccctgccatcgtgcccgccgcccggaaggcc
accgctgcggtgattttcctgcatggattgggagatactgggcacggatgggcagaagcc
tttgcaggtatcagaagttcacatatcaaatatatctgcccgcatgcgcctgttaggcct
gttacattaaatatgaacatggctatgccttcatggtttgatattattgggctttcacca
gattcacaggaggatgaatctgggattaaacaggcagcagaaaatataaaagctttgatt
gatcaagaagtgaagaatggcattccttctaacagaattattttgggagggttttctcag
ggaggagctttatctttatatactgcccttaccacgcagcagaaactagcaggtgtcact
gcactcagttgttggcttccacttcgggcttcctttccacagggtcctgtcggtggtgct
aatagagatatttctattctccagtgccacggggattgtgaccctttagttcccctgatg
tttggttctcttacggttgaaaaactaaaaacattggtgaatccagtcaatgtgaccttt
aaaacctatgaaggtatgatgcacagttcgtgtcaacaggaaatgatggatgtcaagcaa
ttcattgataaactcctacctccaattgattga

KEGG   Macaca mulatta (rhesus monkey): 721016
Entry
721016            CDS       T01028                                 

Definition
(RefSeq) acyl-protein thioesterase 1-like
  KO
K06128  lysophospholipase I [EC:3.1.1.5]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00564  Glycerophospholipid metabolism
mcc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    721016
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    721016
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     721016
SSDB
Motif
Pfam: Abhydrolase_2 Abhydrolase_6 Hydrolase_4 Abhydrolase_1 Cutinase FSH1 Palm_thioest Abhydrolase_3 DUF2974
Other DBs
NCBI-GeneID: 721016
NCBI-ProteinID: XP_028704014
LinkDB
Position
5
AA seq 180 aa
MCRNNMSARLPAIMPAAWKATAAVIFLHGLGDTGHGWTEAFAGIRSSHIKYICPHASDII
GLSPDSQEDEPGIKQAVENIKAFIDQEVKNGIPSNRIILGGFSQGGALSLYTVLTTQQKL
TGVTAFRCWFLFRASFPQGPISGANRDISIFQCHRDCDPLVPLVFGSLTVEKLKTLVKPS
NT seq 543 nt   +upstreamnt  +downstreamnt
atgtgcagaaacaacatgtcagcccggctgccagccatcatgcccgccgcctggaaggcc
accgccgcggtgattttccttcacggcttgggagatactgggcatggatggacagaagcc
tttgcaggtatcagaagttcacatatcaaatatatctgcccgcatgcgtctgatattatt
gggctttcaccagattcacaagaggatgaacctgggattaaacaggcagttgaaaatata
aaggctttcattgatcaagaagtgaaaaatggcattccttctaacagaattattttggga
ggattttctcagggaggagctttatctttatatactgtccttaccacgcagcagaaactg
acgggtgtcactgcgttcagatgctggtttctatttcgggcttcatttccacagggtcct
atcagtggcgctaatagagatatttctattttccagtgccacagagattgtgacccgtta
gttcccctggtgtttggttctcttacggttgaaaaactaaaaacattggtaaaaccttca
tag

DBGET integrated database retrieval system