KEGG   Macaca mulatta (rhesus monkey): 693737
Entry
693737            CDS       T01028                                 

Gene name
SOCS7
Definition
(RefSeq) suppressor of cytokine signaling 7 isoform X5
  KO
K04699  suppressor of cytokine signaling 6/7
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04630  JAK-STAT signaling pathway
mcc04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    693737 (SOCS7)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    693737 (SOCS7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mcc04121]
    693737 (SOCS7)
Ubiquitin system [BR:mcc04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     693737 (SOCS7)
SSDB
Motif
Pfam: SOCS_box SH2
Other DBs
NCBI-GeneID: 693737
NCBI-ProteinID: XP_001082440
Ensembl: ENSMMUG00000020531
LinkDB
Position
16
AA seq 610 aa
MQGAELRDGEAAAAAASYRVLSRLLGYGEAAPEPGPPPPPPGHGPPPPPFLARPGPRGSR
PPQLMVFRNVGRPPEEEDVEAAPEPGPSELLCPRHRCALDPKALPPGLALERTWGPAAGL
EAQLAALGLGQPAGPGVKTVGGGCCPCPCPPQPPPPQPQPPAVAPQAGEDPTETSDALLV
LEGLESEAESLETNSCSEEELSSPGRGGGGGGRLLLQPPGPELPPVPFPLQDLVPLGRLS
RGEQQQQQQQPPPPPPPPGPLRPLAGPSRKGSFKIRLSRLFRTKSCNGGSGGGDGTGKRP
SGELAASAASLTDMGGSAGRELDAGRKPRLTRTQSAFSPVSFSPLFTGETVSLVDVDISQ
RGLTSPHPPTPPPPPRRSLSLLDAFPRIAPIRAAESLHSQPPQHLQCPLYRPDSSSFAAS
LRELEKCGWYWGPMNWEDAEMKLKGKPDGSFLVRDSSDPRYILSLSFRSQGITHHTRMEH
YRGTFSLWCHPKFEDRCQSVVEFIKRAIMHSKNGKFLYFLRSRVPGLPPTPVQLLYPVSR
FSNVKSLQHLCRFRIRQLVRIDHIPDLPLPKPLISYIRKFYYYDPQEEVYLSLKEAQLIS
KQKQEVEPST
NT seq 1833 nt   +upstreamnt  +downstreamnt
atgcagggggccgagctccgggatggcgaggcggcggcggcggccgcttcgtaccgcgtc
ctgagccgcctccttggctatggagaggcggcccccgagccaggcccgccgccgccgccc
ccgggccatggccccccgccgccacccttcctcgcgcggcccggcccgcggggctcccgg
ccgccgcagctgatggtgttccgcaacgtgggtcggccgccggaggaggaggacgtggag
gcggccccggagccgggaccctcggaactgttgtgtccccggcaccgctgtgccctggac
cccaaggccctgccgccgggcttggcgctcgagcggacctggggcccggcggctggacta
gaggcgcagttggcggctctggggctcgggcagccggcagggccgggggtcaagacagtc
ggtgggggttgctgcccgtgcccgtgtccccctcagccgccccctccgcagccccagccg
cctgctgtcgccccgcaggccggggaggaccccacggaaacaagcgacgcgctgctagtc
ctggagggcttggaatcggaggccgagagcctggagactaacagctgctcggaagaggag
ctcagcagcccgggtcgcggaggaggagggggcggccggcttctgctgcagcccccaggc
cctgaattacctccggtgcccttcccgctgcaggacttggtccctctggggcgcctgagt
agaggggagcagcagcagcagcagcagcaacctcccccgcccccgcctcctcctgggccc
ctccggccactcgcgggtccttctcggaagggctccttcaaaatccgcctcagtcgcctc
tttcgcaccaagagctgcaacggtggctccggcggtggggatgggaccggcaagaggcct
tctggagagctggctgcttcagctgcgagcctgacagacatgggaggttctgcgggccgg
gagctggacgcggggaggaaacccaggttgacaagaactcaaagtgccttttctccagtc
tccttcagccccctgttcacaggtgaaactgtgtcgcttgtggatgtggacatttctcag
cggggcctgacctctccacaccctccaactccccctcctcctccaagaagaagcctcagc
ctcctagatgcatttccccggattgctcccatccgagcagctgaatccctgcacagccaa
cccccacagcacctccagtgtcctctctatcggcctgactcgagcagctttgcagccagc
cttcgagagttggagaagtgtggttggtattgggggccaatgaattgggaagatgcagag
atgaagctgaaagggaaaccagatggttctttcctggtacgagacagttctgatcctcgt
tacatcctgagcctcagtttccgatcgcagggtatcacccaccacactagaatggagcac
tacagaggaaccttcagcctgtggtgtcatcctaagtttgaggaccgctgtcaatctgtt
gtagagtttattaagagagccattatgcactccaagaatggaaagtttctctatttctta
agatccagggttccaggactgccaccaactcctgtccagctgctctatccagtgtcccga
ttcagcaatgtcaaatccctccagcacctttgcagattccggatacgacagctcgtcagg
atagatcacatcccagatctcccactgcctaaacctctgatctcttatatccgaaagttc
tactactatgatcctcaggaagaggtatacctgtctctaaaggaagcgcagctcatttcc
aaacagaagcaagaggtggaaccctccacgtag

KEGG   Macaca mulatta (rhesus monkey): 696146
Entry
696146            CDS       T01028                                 

Gene name
SOCS4
Definition
(RefSeq) suppressor of cytokine signaling 4
  KO
K04697  suppressor of cytokine signaling 4
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04630  JAK-STAT signaling pathway
mcc04910  Insulin signaling pathway
mcc04917  Prolactin signaling pathway
mcc04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    696146 (SOCS4)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    696146 (SOCS4)
   04917 Prolactin signaling pathway
    696146 (SOCS4)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    696146 (SOCS4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mcc04121]
    696146 (SOCS4)
Ubiquitin system [BR:mcc04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     696146 (SOCS4)
SSDB
Motif
Pfam: SOCS SOCS_box SH2
Other DBs
NCBI-GeneID: 696146
NCBI-ProteinID: NP_001180749
Ensembl: ENSMMUG00000000304
UniProt: F6YVE7 H9Z1L1
LinkDB
Position
7
AA seq 440 aa
MAENNENNSKNVDVRPKTSRSRSADRKDGYVWSGKKLSWSKKSESYSDAETVNGIEKTEV
SLRNRERKHSCSSIELDLDHSCGHRFLGRSLKQKLQDAVGQCFPIKNCSSRHSSGLPSKR
KIHISELMLDKCPFPPRSDLAFRWHFIKRHTAPINSKSDEWVSTDLSQTELRDGQLKLRN
MEENINCFSHTNVQPCVITTDNALCREDPMTGSVMNLVSNNSIEDSDMDSDDEILTLCTS
SRKRNKPKWELDDEILQLETPPKYHTQIDYVHCLVPDLLQINNNPCYWGVMDKYAAEALL
EGKPEGTFLLRDSAQEDYLFSVSFRRYSRSLHARIEQWNHNFSFDAHDPCVFHSPDITGL
LEHYKDPSACMFFEPLLSTPLIRTFPFSLQHICRTVICNCTTYDGINALPIPSSMKLYLK
EYHYKSKVRVLRIDAPEQQC
NT seq 1323 nt   +upstreamnt  +downstreamnt
atggcagaaaataatgaaaataatagtaaaaatgtagacgtaaggcccaagactagtcgg
agcagaagtgccgacagaaaagatggttatgtgtggagtggaaagaagttatcttggtca
aaaaagagtgagagttattcagatgctgaaacggtgaatggtatagagaaaactgaagtg
tctttaaggaaccgagaaaggaagcacagctgttcatccattgagttggacttagatcat
tcctgtgggcatagatttttaggccgatctcttaaacaaaaactgcaagatgccgtgggg
cagtgttttccaataaagaattgtagtagtcggcactcttcagggcttccatctaaaagg
aaaattcatatcagtgaactcatgttagataagtgtcctttcccacctcgatcagattta
gcctttaggtggcattttattaaacgacacactgctcctataaattccaaatcagatgaa
tgggtaagcacagacttgtctcagactgaattgagggatggtcagctaaaactaagaaat
atggaagaaaatataaactgtttctcacataccaatgttcagccctgtgtcataaccacc
gacaatgctttgtgtagagaagatcctatgactggctctgtgatgaacctggtttcaaat
aacagtatagaagatagtgatatggattccgatgatgaaattctaacactttgcacaagt
tccagaaaaagaaacaaacccaaatgggaattggatgatgaaatcctgcagttggaaaca
cctcctaaataccacacgcagattgattatgtccactgtcttgtaccagacctccttcag
atcaataacaacccatgttactggggagtaatggataaatatgcagccgaagcactactg
gaaggaaaaccagagggtacctttttacttcgagactcagcacaggaagactatttattc
tctgttagctttagacgctatagtcgttctcttcatgctagaattgaacagtggaatcac
aactttagctttgatgcacatgacccctgtgtctttcattctcctgacattactgggctt
ctagaacattataaggacccaagcgcctgtatgttctttgaaccactgctgtccactcct
ttaattcggactttccccttttccctgcagcatatatgcagaacagttatttgtaactgt
acgacttatgatggcatcaatgcccttccaattccttcttctatgaaattatatctgaag
gaatatcattataaatcaaaagttagagtactcaggattgatgcaccagaacagcaatgc
tag

KEGG   Macaca mulatta (rhesus monkey): 704108
Entry
704108            CDS       T01028                                 

Gene name
SOCS6
Definition
(RefSeq) suppressor of cytokine signaling 6
  KO
K04699  suppressor of cytokine signaling 6/7
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04630  JAK-STAT signaling pathway
mcc04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    704108 (SOCS6)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    704108 (SOCS6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mcc04121]
    704108 (SOCS6)
Ubiquitin system [BR:mcc04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     704108 (SOCS6)
SSDB
Motif
Pfam: SH2 SOCS_box
Other DBs
NCBI-GeneID: 704108
NCBI-ProteinID: XP_001095656
Ensembl: ENSMMUG00000012610
UniProt: H9ERN5
LinkDB
Position
18
AA seq 535 aa
MKKISLKTLRKSFNLNKSKEETDFMVVQQPSLASDFGKDDSLFGSCYGKDMASCDINGEE
EKGGKNRSKSESLMGTLKRRLSAKQKPKGKAGTPSGSSADEDTFSSSSAPIVFKDVRAQR
PIRSTSLRSHHYSPTPWPLRPTNSEETCIKMEVRVKALVHSSSPSPALNGVRKDFHDLQN
ETACQEQANSLKSSASHNGDLHLHLDEHVPVVIGLMPQDYIQYTVPLDEGMYPLEGSRSY
CLDSSSPMEVSAVPPPGGGRAFPEDESQVDQDLVVAPEIFVDQSVNGLLIGTTGVMLQSP
RAGHDDVPPLSPLLPPMQNNQIQRNFSGLTGTEAHVAESMRCHLNFDPNSAPGVARVYDS
VQSSGPMVVTSLTEELKKLAKQGWYWGPITRWEAEGKLANVPDGSFLVRDSSDDRYLLSL
SFRSHGKTLHTRIEHSNGRFSFYEQPDVEGHTSIVDLIEHSIRDSENGAFCYSRSRLPGS
ATYPVRLTNPVSRFMQVRSLQYLCRFVIRQYTRIDLIQKLPLPNKMKDYLQEKHY
NT seq 1608 nt   +upstreamnt  +downstreamnt
atgaagaaaattagtcttaaaaccttacggaaatcttttaacttgaataaaagtaaagaa
gaaactgatttcatggtagtacaacaaccatcgctagccagtgactttggaaaagatgat
tccttgtttggtagctgctatggtaaagatatggccagctgcgatatcaacggtgaagag
gaaaaaggcggaaaaaacagatcgaaaagcgagagcctgatgggtacgctcaaaaggcgg
ctttctgcaaaacagaagccaaaaggcaaggcgggcacgccctccgggagctctgccgac
gaggacaccttctcctcctcctcagcacccatcgtctttaaagacgtgagagcccagagg
ccgataaggtccacctcgctccgcagccatcactacagccccacgccgtggcctctgcgg
cccacgaactccgaggagacctgcatcaagatggaggtgagagtcaaggccttggttcac
tcttccagcccgagtccagccctgaacggcgtgcggaaggatttccacgacctccagaac
gagaccgcgtgccaagagcaagccaattcactgaagagctcggcttctcataacggagac
ctgcatctccacctggatgaacatgtgcctgtcgttattggacttatgcctcaggactac
attcagtatactgtgcctttagatgaggggatgtatcctttggaaggatcgcggagctat
tgtctggacagctcttctcccatggaagtctctgcggttcctcctccagggggagggcgc
gctttccccgaagatgagagtcaggtagaccaggacctggttgtcgccccagagatcttc
gtggatcagtccgtgaacggcttgttgattggcaccacgggagtcatgttgcagagcccg
agagcgggtcacgatgatgtccctccactctcaccattgctacctccaatgcagaataat
caaatccaaaggaacttcagtggactcactggcacagaagcccacgtggctgaaagtatg
cgctgtcatttgaattttgatccgaactctgctcctggggttgcaagagtgtacgactca
gtgcaaagtagtggtcccatggtcgtgacaagccttacagaggagctgaaaaaacttgca
aaacaaggatggtactggggacccatcacacgttgggaggctgaagggaagctagcaaac
gtgccagatggttcttttcttgttcgggacagttctgacgaccgttatcttttaagcttg
agctttcgctctcatggtaaaacacttcacactagaattgagcactcaaacggtaggttt
agcttttatgaacagcccgatgtggaaggacatacgtccatagttgatctaattgagcat
tcaatcagggactctgaaaatggagctttttgttattcaaggtctcggctgcctggatct
gcaacttaccccgtcagactgaccaacccagtgtcccggttcatgcaggtgcgctcgttg
cagtacctgtgtcgttttgttatacgtcagtacaccagaatagacttaattcagaaactg
cctttgccaaacaaaatgaaggattatttacaggagaagcactactga

KEGG   Macaca mulatta (rhesus monkey): 711180
Entry
711180            CDS       T01028                                 

Gene name
SOCS1
Definition
(RefSeq) suppressor of cytokine signaling 1
  KO
K04694  suppressor of cytokine signaling 1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04120  Ubiquitin mediated proteolysis
mcc04380  Osteoclast differentiation
mcc04630  JAK-STAT signaling pathway
mcc04910  Insulin signaling pathway
mcc04917  Prolactin signaling pathway
mcc04930  Type II diabetes mellitus
mcc04935  Growth hormone synthesis, secretion and action
mcc05145  Toxoplasmosis
mcc05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    711180 (SOCS1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    711180 (SOCS1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    711180 (SOCS1)
   04917 Prolactin signaling pathway
    711180 (SOCS1)
   04935 Growth hormone synthesis, secretion and action
    711180 (SOCS1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    711180 (SOCS1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    711180 (SOCS1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    711180 (SOCS1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    711180 (SOCS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mcc04121]
    711180 (SOCS1)
Ubiquitin system [BR:mcc04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     711180 (SOCS1)
SSDB
Motif
Pfam: SH2 SOCS_box
Other DBs
NCBI-GeneID: 711180
NCBI-ProteinID: XP_001104595
Ensembl: ENSMMUG00000010956
UniProt: F7GGH3
LinkDB
Position
20
AA seq 215 aa
MVAHNQVAADNAVSTAAEPRRRPEPSSSSSSSPAAPARPRPCPAVPAPAPAPAPGDTHFR
TFRSHADYRRITRASALLDACGFYWGPLSVHGAHERLRAEPVGTFLVRDSRQRNCFFALS
VKMASGPTSIRVHFQAGRFHLDGSRESFDCLFELLEHYVAAPRRMLGTPLRQRRVRPLQE
LCRQRIVATVGRENLARIPLNPVLRDYLSSFPFQI
NT seq 648 nt   +upstreamnt  +downstreamnt
atggtagcacacaaccaggtggcagccgacaatgcagtctccacagcagcagagccccga
cggcggccagagccttcctcctcttcctcctcctcgcccgcggccccagcgcgcccgcgg
ccgtgcccggcggtcccggccccggccccggccccggcccccggcgacacgcacttccgc
acgttccgttcgcacgccgattaccggcgcataacgcgcgccagcgcgcttctcgacgcc
tgcggcttctactgggggcccctgagcgtgcacggagcacacgagcggctgcgcgccgag
cccgtgggcaccttcctggtgcgcgacagccgccagcggaactgcttcttcgccctcagc
gtgaagatggcctcgggccccacgagcatccgcgtgcacttccaggccggccgcttccac
ctggacggcagccgcgagagcttcgactgcctcttcgagttgctggagcactacgtggcg
gcgccgcgtcgcatgctggggaccccgctgcgccagcgccgcgtccggccgcttcaggag
ctgtgccgccagcgcatcgtggccaccgtgggccgcgagaacctggcgcgcatccccctc
aaccccgtcctccgcgactatttgagctccttccccttccagatctga

KEGG   Macaca mulatta (rhesus monkey): 714998
Entry
714998            CDS       T01028                                 

Gene name
SOCS5
Definition
(RefSeq) suppressor of cytokine signaling 5
  KO
K04698  suppressor of cytokine signaling 5
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04630  JAK-STAT signaling pathway
mcc04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    714998 (SOCS5)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    714998 (SOCS5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mcc04121]
    714998 (SOCS5)
Ubiquitin system [BR:mcc04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     714998 (SOCS5)
SSDB
Motif
Pfam: SOCS SOCS_box SH2 BRCT_assoc
Other DBs
NCBI-GeneID: 714998
NCBI-ProteinID: NP_001253857
Ensembl: ENSMMUG00000039303
UniProt: F7GUL4
LinkDB
Position
13
AA seq 536 aa
MDKVGKMWNNFKYRCQNLFGHEGGSRSENVDMNSNRCLSVREKNISIGDSTPQQQSSPLR
ENVALQLGLSPSKNSSRRNQNCATEIPQIVEISIEKDNDSCVTPGTRLARRDSYSRHAPW
GGKKKHSCSTKTQSSLDADKKFGRTRSGLQRRERRYGVSSVHDMDSVSSRTVGSRSLRQR
LQDTVGLCFPMRTYSKQSKPLFSNKRKIHLSELMLEKCPFPAGSDLAQKWHLIKQHTAPV
SPHSTFFDTFDPSLVSTEDEEDRLRERRRLSIEEGVDPPPNAQIHTFEATAQVNPLYKLG
PKLAPGMTEISGDSSAIPQANCDSEEDTTTLCLQSRRQKQRQISGDSHTHVSRQGAWKVH
TQIDYIHCLVPDLLQITGNPCYWGVMDRYEAEALLEGKPEGTFLLRDSAQEDYLFSVSFR
RYNRSLHARIEQWNHNFSFDAHDPCVFHSSTVTGLLEHYKDPSSCMFFEPLLTISLNRTF
PFSLQYICRAVICRCTTYDGIDGLPLPSMLQDFLKEYHYKQKVRVRWLEREPVKAK
NT seq 1611 nt   +upstreamnt  +downstreamnt
atggataaagtggggaaaatgtggaataacttcaaatacaggtgtcagaatctcttcggt
catgagggaggaagccgtagtgaaaatgtggacatgaactccaacagatgtttgtctgtc
agagagaaaaacatcagcataggagactcaactcctcagcaacaaagcagtcccttaaga
gaaaatgttgccttacaactgggattaagcccttcaaagaattcttcaaggagaaatcaa
aattgtgccacagaaatccctcaaattgttgaaataagcatcgaaaaggataatgattct
tgtgttaccccaggaacaagacttgcacgaagagattcctactctcgacatgctccatgg
ggtgggaagaaaaaacattcctgttctacaaagacccagagttcattggatgctgataag
aagtttggtagaactcgaagtggacttcaaaggagagagaggcgctacggcgtaagttct
gtacacgacatggacagtgtttccagcagaactgtaggaagtcgctctctgagacagagg
ttgcaggatactgtgggcttgtgttttcccatgagaacttacagcaagcagtcaaagcct
ctcttttccaataaaagaaaaatccatctgtctgaattaatgcttgagaaatgcccattt
cctgctggctcagatttagcccaaaaatggcatttgattaaacagcatacagctcctgtg
agcccacattcaacattttttgatacatttgatccatctttggtttctacagaagatgaa
gaagataggcttagagagagaaggcggcttagtattgaagaaggggttgatccccctccc
aatgcacaaatacatacatttgaagctactgcacaggttaatccattatataaactggga
ccaaagttagctcctggaatgactgaaataagtggggacagttctgcaattccacaagct
aattgtgactcggaagaggatacaaccaccctgtgtttgcagtcacggaggcagaagcag
cgtcagatatctggagacagccatacccatgttagcagacagggagcttggaaagtccac
acacagattgattacatacactgcctcgtgcctgatttgcttcaaattacagggaatccc
tgttactggggagtgatggaccgttatgaagcagaagcccttctcgaagggaaacctgaa
ggcacgtttttgctcagggactctgcgcaagaggactacctcttctctgtgagcttccgc
cgctacaacagatccctgcatgcccgaattgagcagtggaatcacaactttagtttcgat
gcccatgacccctgtgtatttcactcctccactgtaacaggacttttagaacattataaa
gatcccagttcgtgcatgttttttgaaccattgcttactatatcactaaataggactttt
ccttttagcctgcagtatatctgtcgcgcggtaatctgcaggtgcactacgtatgatgga
attgatgggctccctctaccctcaatgttacaggattttttaaaagagtatcattataaa
caaaaagttagagttcgctggttagaacgagaaccagtcaaggcaaagtaa

KEGG   Macaca mulatta (rhesus monkey): 715680
Entry
715680            CDS       T01028                                 

Gene name
SOCS3
Definition
(RefSeq) suppressor of cytokine signaling 3
  KO
K04696  suppressor of cytokine signaling 3
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04120  Ubiquitin mediated proteolysis
mcc04380  Osteoclast differentiation
mcc04630  JAK-STAT signaling pathway
mcc04668  TNF signaling pathway
mcc04910  Insulin signaling pathway
mcc04917  Prolactin signaling pathway
mcc04920  Adipocytokine signaling pathway
mcc04930  Type II diabetes mellitus
mcc04931  Insulin resistance
mcc04932  Non-alcoholic fatty liver disease
mcc04935  Growth hormone synthesis, secretion and action
mcc05160  Hepatitis C
mcc05164  Influenza A
mcc05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    715680 (SOCS3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    715680 (SOCS3)
   04668 TNF signaling pathway
    715680 (SOCS3)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    715680 (SOCS3)
   04920 Adipocytokine signaling pathway
    715680 (SOCS3)
   04917 Prolactin signaling pathway
    715680 (SOCS3)
   04935 Growth hormone synthesis, secretion and action
    715680 (SOCS3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    715680 (SOCS3)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    715680 (SOCS3)
   04932 Non-alcoholic fatty liver disease
    715680 (SOCS3)
   04931 Insulin resistance
    715680 (SOCS3)
  09172 Infectious disease: viral
   05160 Hepatitis C
    715680 (SOCS3)
   05164 Influenza A
    715680 (SOCS3)
   05168 Herpes simplex virus 1 infection
    715680 (SOCS3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mcc04121]
    715680 (SOCS3)
Ubiquitin system [BR:mcc04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     715680 (SOCS3)
SSDB
Motif
Pfam: SH2 SOCS_box
Other DBs
NCBI-GeneID: 715680
NCBI-ProteinID: NP_001181255
Ensembl: ENSMMUG00000017522
LinkDB
Position
16
AA seq 225 aa
MFTLSKCPAAGMMRPLDSRLRLKTFRSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLL
SAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCV
LKLVHHYMPPPGAPSFPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSR
PLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
NT seq 678 nt   +upstreamnt  +downstreamnt
atgttcaccctcagcaagtgtcccgccgccgggatgatgcgccccctggactccagactg
cggctcaagaccttcaggtccaagagcgagtaccagctggtggtgaacgcagtgcgcaag
ctgcaggagagcggcttctactggagcgcagtgaccggcggcgaggcgaacctgctgctc
agcgccgagcccgctggcacctttctgattcgcgacagctcggaccagcgccactttttc
acgctcagcgtcaagacccagtctgggaccaagaacctgcgcatccagtgtgaggggggc
agcttctctctgcagagcgatccccggagcacgcagcctgtgcctcgcttcgactgcgtg
ctgaagctggtgcaccactacatgccgccccctggagccccctctttcccctcgccacct
actgaaccctcctccgaggtgcccgagcagccgtctgcccagccactccctggaagtccc
cccagaagagcctactacatctactccgggggcgagaagatccccctggtgttgagccgg
cccctctcctccaacgtggccactcttcagcatctctgtcggaagaccgtcaacggccac
ctggactcctatgagaaagtcacccagctgccggggcccattcgggagttcctggaccag
tacgatgccccgctttaa

KEGG   Macaca mulatta (rhesus monkey): 715772
Entry
715772            CDS       T01028                                 

Gene name
SOCS2
Definition
(RefSeq) suppressor of cytokine signaling 2
  KO
K04695  suppressor of cytokine signaling 2
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04630  JAK-STAT signaling pathway
mcc04910  Insulin signaling pathway
mcc04917  Prolactin signaling pathway
mcc04930  Type II diabetes mellitus
mcc04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    715772 (SOCS2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    715772 (SOCS2)
   04917 Prolactin signaling pathway
    715772 (SOCS2)
   04935 Growth hormone synthesis, secretion and action
    715772 (SOCS2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    715772 (SOCS2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mcc04121]
    715772 (SOCS2)
Ubiquitin system [BR:mcc04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     715772 (SOCS2)
SSDB
Motif
Pfam: SOCS_box SH2 SH2_2 Condensation
Other DBs
NCBI-GeneID: 715772
NCBI-ProteinID: NP_001181691
Ensembl: ENSMMUG00000047406
UniProt: F7E320 G7N7Y9
LinkDB
Position
11
AA seq 198 aa
MTLRCLEPSGNGGEGTRSQWGTAGSAEEPSPEAARLAKALRELGQTGWYWGSMTVNEAKE
KLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFD
SVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTNPLYISAPSLQHLCRLTINKCTGAIWG
LPLPTRLKDYLEEYKFQV
NT seq 597 nt   +upstreamnt  +downstreamnt
atgaccctgcggtgcctcgagccctccgggaatggcggagaagggacgcggagccagtgg
gggaccgcggggtcggcggaggagccatccccggaggcggcgcgtctggcgaaggccctg
cgggagctgggtcagacaggatggtactggggaagtatgactgttaatgaagccaaagag
aaattaaaagaggcaccagaaggaactttcttgattagagatagctcgcattcagactac
ctactaacaatatctgttaaaacgtcagctggaccaactaatcttcgaatcgaataccaa
gatggaaaattcagattggactctatcatatgtgtcaaatccaagctgaaacaatttgac
agtgtggttcatctgatcgactactatgttcagatgtgcaaggataagcggacaggtcca
gaagccccccggaacggcaccgttcacctttatctgaccaacccgctctacatatcagca
ccatctctgcagcatctctgtaggctcaccattaacaaatgtactggtgccatctgggga
ctgcctttaccaacaagactaaaagattacttggaagaatataaattccaggtataa

DBGET integrated database retrieval system