KEGG   Macaca mulatta (rhesus monkey): 693913
Entry
693913            CDS       T01028                                 

Gene name
TBKBP1
Definition
(RefSeq) TANK-binding kinase 1-binding protein 1 isoform X1
  KO
K12652  TANK-binding kinase 1-binding protein
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04622  RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    693913 (TBKBP1)
SSDB
Motif
Pfam: TBD Zn-C2H2_12 CT_C_D Seryl_tRNA_N Bacillus_HBL
Other DBs
NCBI-GeneID: 693913
NCBI-ProteinID: XP_001082242
Ensembl: ENSMMUG00000019762
UniProt: F7AQP5
LinkDB
Position
16
AA seq 615 aa
MESMFEDDISILRQEALGPSEVWLDGPGDPSLGDDMCSASHFALITAYGDIKERLGGLER
ENATLRRRLKVYEIKYPLISDFGEEHGFSLYEIKDGSLLEVEKVSLQQRLNQFQHELQKN
KEQEEQLGEMIQAYEKLCVEKSDLETELGEMRALVETHLRQICGLEQQLRQQQGLRDAAF
SNLSPPPAPAPPCADLDLHYLALRGGSGLSHAGWPGPTPSVSDLERRRLEEALEAAQGEA
RGAQLREEQLQAECERLQGELKQLQETRAQDLASNQSERDMAWVKRVGDDQVNLALAYTE
LTEELGRLRELSSLQGKILRTLLQEQARSGGQRHSPLSQRHSPAPQCPSPSPPARAAPPC
PPCQSPVPQRRSPVPPCPSPQQRRSPASPSCPSPVPQRRSPVPPPCQSPSPQRRSPVPPS
CPAPQPRPPPPPPPGERTLAERAYAKPPSHHVKAGFQGRRSYSELAEGAAYMGASPPWLQ
AEAATLPKPRAYGSELYGPGRPLSPRRAFEGIRLRFEKQPSEEDEWAVPTSPPSPEVGTI
RCASFCAGFPIPESPAATAYAHAEHAQSWPSINLLMETVGSDIRSCPLCQLGFPVGYPDD
ALIKHIDSHLENSKI
NT seq 1848 nt   +upstreamnt  +downstreamnt
atggagtccatgttcgaggacgacatcagcatactgaggcaggaggccctggggcccagt
gaagtgtggctagacggtcccggagacccctcccttggggacgacatgtgctctgcctcc
cactttgccctcatcacggcttacggagacatcaaggaaaggctggggggcctggagagg
gagaacgccaccctccgacgccgcctcaaagtctacgagatcaagtacccactgatcagt
gactttggagaggagcatggcttttctctgtatgaaatcaaggatggctccctgctggag
gtggagaaggtcagcctgcagcaacggctcaaccagttccagcacgagttacagaagaac
aaggagcaggaagaacagcttggagagatgatccaggcctatgagaaactctgcgtggag
aagagcgacttggagacggagcttggggagatgagggccctggtggagacgcacctgcgc
cagatctgtggtttggagcagcagctgcggcaacagcaaggcctccgggatgcagccttc
tctaacctgagcccgccgccagcccccgcgccgccctgcgctgatttggacctgcactac
ctggcactgagagggggatctggcttgagtcatgcaggctggccgggccccacacccagt
gtgagtgacctggagcggcggcggctagaagaggctttggaggcagcgcagggagaggcc
cggggggctcagctccgggaggagcagcttcaggcagagtgtgagcggctgcagggggag
ctgaagcagctgcaggagacccgggcccaggatctggcctccaaccagtcggagcgggac
atggcatgggtgaaaagagttggggacgatcaggtgaatttggcgctggcctacacggag
ctgacagaggagctgggccggcttcgggagttgagttccctacaggggaaaatcttgagg
actctgttgcaggagcaggcccggagtggcggccagaggcactcgccactgtcacagcgc
cactcgccggccccccagtgcccctccccctccccgcctgcccgagcggctcccccttgc
cccccgtgccagtcccccgtcccccagcgccgctcacccgtgcccccgtgcccctcgccg
cagcagcgccgctctccggcctcgccctcctgcccgtcgcccgtcccgcagcgccgctcg
ccggtgccgccgccgtgccagtcccccagcccgcagcgccgttccccggtgccccccagc
tgcccggccccgcagccccggccgccgccgccgcccccgccgggcgagaggacgctggcc
gagcgcgcctacgccaagccgcccagccaccacgtgaaggccggcttccagggccgccgc
agctactcagagctggcggagggcgcggcctacatgggcgcctccccgccctggctgcag
gccgaggcggccacgcttcccaagccccgggcctacggcagcgagctctacggccccggc
aggcccctcagcccgcggcgcgccttcgagggcatccggctgcgcttcgagaagcagccg
tcggaggaggacgagtgggctgtgcccaccagcccgcccagcccggaggtgggcactatc
cgctgcgcctccttctgcgcgggcttccccatccccgagtcgccagccgccaccgcctac
gcccacgccgagcacgcgcagtcctggccgtccatcaacttgctgatggagacggtgggc
tccgacatccgcagctgtcccctctgccagctgggtttccctgtcgggtacccggatgat
gccctcatcaaacacattgactcccacctggagaacagcaagatctag

DBGET integrated database retrieval system