KEGG   Macaca mulatta (rhesus monkey): 693914
Entry
693914            CDS       T01028                                 

Gene name
MAP2K6
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 6
  KO
K04433  mitogen-activated protein kinase kinase 6 [EC:2.7.12.2]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04010  MAPK signaling pathway
mcc04015  Rap1 signaling pathway
mcc04218  Cellular senescence
mcc04380  Osteoclast differentiation
mcc04620  Toll-like receptor signaling pathway
mcc04664  Fc epsilon RI signaling pathway
mcc04668  TNF signaling pathway
mcc04750  Inflammatory mediator regulation of TRP channels
mcc04912  GnRH signaling pathway
mcc04935  Growth hormone synthesis, secretion and action
mcc05014  Amyotrophic lateral sclerosis
mcc05022  Pathways of neurodegeneration - multiple diseases
mcc05132  Salmonella infection
mcc05135  Yersinia infection
mcc05145  Toxoplasmosis
mcc05161  Hepatitis B
mcc05163  Human cytomegalovirus infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mcc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    693914 (MAP2K6)
   04015 Rap1 signaling pathway
    693914 (MAP2K6)
   04668 TNF signaling pathway
    693914 (MAP2K6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    693914 (MAP2K6)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    693914 (MAP2K6)
   04664 Fc epsilon RI signaling pathway
    693914 (MAP2K6)
  09152 Endocrine system
   04912 GnRH signaling pathway
    693914 (MAP2K6)
   04935 Growth hormone synthesis, secretion and action
    693914 (MAP2K6)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    693914 (MAP2K6)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    693914 (MAP2K6)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    693914 (MAP2K6)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    693914 (MAP2K6)
   05022 Pathways of neurodegeneration - multiple diseases
    693914 (MAP2K6)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    693914 (MAP2K6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    693914 (MAP2K6)
   05135 Yersinia infection
    693914 (MAP2K6)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    693914 (MAP2K6)
   05161 Hepatitis B
    693914 (MAP2K6)
   05163 Human cytomegalovirus infection
    693914 (MAP2K6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    693914 (MAP2K6)
   05169 Epstein-Barr virus infection
    693914 (MAP2K6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    693914 (MAP2K6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    693914 (MAP2K6)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     693914 (MAP2K6)
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: STE group
  STE7 family
   693914 (MAP2K6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal Choline_kinase DUF4344 APH
Other DBs
NCBI-GeneID: 693914
NCBI-ProteinID: NP_001248635
Ensembl: ENSMMUG00000001051
UniProt: H9EP89
LinkDB
Position
11
AA seq 334 aa
MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELG
RGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALF
REGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDV
KPSNVLINALGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDI
WSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSK
ERPTYPELMQHPFFTLHESKGTDVASFVKLILGD
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgtctcagtcgaaaggcaagaagcgaaaccctggccttaaaattccaaaagaagcattt
gagcaacctcagaccagttccacaccacctcgagatttagactccaaggcttgcatttct
attggaaatcagaactttgaggtgaaggcagatgacctagagcctataatggaactggga
cgaggtgcgtacggggtggtggagaagatgcggcacgtgcccagcgggcagatcatggca
gtgaagcggattcgagccacagtaaatagccaggaacagaaaaggctactgatggatttg
gatatttccatgaggacggtggactgtccattcaccgtcaccttttatggcgcactgttt
cgggagggtgatgtgtggatctgcatggagctcatggacacatcactagataaattctac
aaacaagttattgataaaggccagacaattccagaggacatcttagggaaaatagcagtt
tctattgtaaaagcattagaacatttacacagtaagctgtctgtcattcacagagacgtc
aagccttctaatgtactcattaatgctctcggtcaagtgaagatgtgcgattttggaatc
agtggctacttggtggactctgttgctaaaacaattgatgcgggttgcaaaccatacatg
gcccctgaaagaataaacccagagctcaaccagaagggatacagtgtgaagtctgacatt
tggagtctgggcatcacgatgattgagttggccatccttcgatttccctatgattcctgg
ggaactccatttcagcagctcaaacaggtggtagaggagccatctccacaactcccagca
gacaagttctctgcagagttcgttgactttacctcacagtgcttaaagaagaattccaaa
gaacggcctacatacccagagctaatgcaacatccatttttcaccctacatgaatccaaa
ggaacagatgtggcatcttttgtaaaactgattcttggagattaa

DBGET integrated database retrieval system