KEGG   Macaca mulatta (rhesus monkey): 693961
Entry
693961            CDS       T01028                                 

Gene name
TRAF3
Definition
(RefSeq) TNF receptor-associated factor 3 isoform X1
  KO
K03174  TNF receptor-associated factor 3
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04064  NF-kappa B signaling pathway
mcc04620  Toll-like receptor signaling pathway
mcc04621  NOD-like receptor signaling pathway
mcc04622  RIG-I-like receptor signaling pathway
mcc04657  IL-17 signaling pathway
mcc04668  TNF signaling pathway
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05162  Measles
mcc05164  Influenza A
mcc05165  Human papillomavirus infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05171  Coronavirus disease - COVID-19
mcc05200  Pathways in cancer
mcc05203  Viral carcinogenesis
mcc05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    693961 (TRAF3)
   04668 TNF signaling pathway
    693961 (TRAF3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    693961 (TRAF3)
   04621 NOD-like receptor signaling pathway
    693961 (TRAF3)
   04622 RIG-I-like receptor signaling pathway
    693961 (TRAF3)
   04657 IL-17 signaling pathway
    693961 (TRAF3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    693961 (TRAF3)
   05203 Viral carcinogenesis
    693961 (TRAF3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    693961 (TRAF3)
  09172 Infectious disease: viral
   05161 Hepatitis B
    693961 (TRAF3)
   05160 Hepatitis C
    693961 (TRAF3)
   05171 Coronavirus disease - COVID-19
    693961 (TRAF3)
   05164 Influenza A
    693961 (TRAF3)
   05162 Measles
    693961 (TRAF3)
   05168 Herpes simplex virus 1 infection
    693961 (TRAF3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    693961 (TRAF3)
   05169 Epstein-Barr virus infection
    693961 (TRAF3)
   05165 Human papillomavirus infection
    693961 (TRAF3)
SSDB
Motif
Pfam: zf-TRAF zf-C3HC4 ATG16 Crescentin zf-C3HC4_2 MPS2 Tropomyosin_1 Spc7 Cast Spc29 zf-RING_4 KxDL T3SSipB FliJ BLOC1_2 DUF1664 Exonuc_VII_L Fib_alpha GAS SPATA24 DUF3450
Other DBs
NCBI-GeneID: 693961
NCBI-ProteinID: XP_015000016
Ensembl: ENSMMUG00000011752
UniProt: A0A1D5RF63
LinkDB
Position
7
AA seq 568 aa
MESSKKMDSPGPLQTNPPLKLHTDRSAGTPIFAPEQGGYKEKFVKTVEDKYKCEKCRLVL
CSPKQTECGHRFCESCMAALLSSSSPKCTACQESVVRDKVFKDNCCKREILALQIYCRNE
SRGCAEQLTLGHLLVHLKNDCHFEELPCVRADCKEKVLRKDLRDHVEKACKYREATCSHC
KSQVPMIALQKHEDTDCPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCV
FQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEI
EIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNR
VTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIW
KIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRG
EYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQ
TVLENGTYIKDDTIFIKVIVDTSDLPDP
NT seq 1707 nt   +upstreamnt  +downstreamnt
atggagtcgagtaaaaagatggactcccctggcccgctgcagactaatccgccgctaaag
ctgcacactgaccgcagtgctgggacgccgatttttgcccctgaacaaggaggttacaag
gaaaagtttgtgaagaccgtggaggacaagtacaagtgtgagaagtgccgcctggtgctg
tgcagcccgaaacagaccgagtgtgggcaccgcttctgcgagagctgcatggctgccctg
ctgagctcttcaagtccaaaatgtacagcgtgtcaagagagcgtcgttagagataaggtg
tttaaggataattgctgcaagagagaaattctggctcttcagatctattgtcggaatgaa
agcagaggttgtgcagagcagttaacgctgggacatctgctggtgcatttaaaaaatgat
tgccattttgaagaacttccatgtgtacgtgctgactgcaaagaaaaggtcttgaggaaa
gacctgcgagaccacgtggagaaggcgtgtaaataccgggaagccacgtgcagccactgc
aagagtcaggttccgatgatcgcgctgcagaaacatgaagacaccgactgtccctgcgtg
gtggtatcctgccctcacaaatgcagcgtccagactctcctgaggagcgagttgagtgca
cacttgtcagagtgtgtcaatgcccccagcacctgtagttttaagcgctatggctgcgtt
tttcaggggacaaaccagcagatcaaggcccacgaggccagctccgccgtgcagcacgtc
aacctgctgaaggagtggagcaactcgctcgaaaagaaggtttccttgttgcagaatgaa
agtgtagaaaaaaacaagagcatacaaagtttgcacaatcagatatgtagctttgaaatt
gaaattgagagacaaaaggaaatgcttcgaaataatgaatccaaaatccttcatttacag
cgagtgatagacagccaagcagagaaactgaaggagctcgacaaagagatccggcccttc
cggcagaactgggaggaagcagacagcatgaagagcagcgtggagtccctccagaaccgt
gtgaccgagctggagagcgtggacaagagcgcggggcaagtggctcggaacacaggcctg
ctggagtcccagctgagccggcatgaccagatgctgagtgtgcacgacatccgcctggcc
gacatggacctgcgcttccaggtcctggagaccgccagctacaacggcgtgctcatctgg
aagattcgtgactacaagcggcggaagcaggaggccgtcatggggaagaccctgtccctt
tacagccagcctttctacactggctactttggctataagatgtgtgccagggtctacctg
aacggggatgggatgggaaaggggacgcacctgtcgctgttttttgtcatcatgcgtgga
gaatatgatgccctgcttccatggccgtttaagcagaaagtgacactcatgctgatggat
caggggtcctctcggcgccatttgggagatgcgttcaagcccgaccccaacagcagcagc
ttcaagaagcccactggagagatgaatatcgcctctggctgcccagtctttgtggcccag
actgttctagaaaatgggacatatattaaagatgatacaatttttattaaagtcatagtg
gatacttcggatctgcccgatccctga

DBGET integrated database retrieval system