KEGG   Macaca mulatta (rhesus monkey): 694117
Entry
694117            CDS       T01028                                 

Gene name
TKFC
Definition
(RefSeq) triokinase/FMN cyclase
  KO
K00863  triose/dihydroxyacetone kinase / FAD-AMP lyase (cyclizing) [EC:2.7.1.28 2.7.1.29 4.6.1.15]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00051  Fructose and mannose metabolism
mcc00561  Glycerolipid metabolism
mcc01100  Metabolic pathways
mcc01200  Carbon metabolism
mcc04622  RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    694117 (TKFC)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    694117 (TKFC)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    694117 (TKFC)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.28  triokinase
     694117 (TKFC)
    2.7.1.29  glycerone kinase
     694117 (TKFC)
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.15  FAD-AMP lyase (cyclizing)
     694117 (TKFC)
SSDB
Motif
Pfam: Dak1 Dak2
Other DBs
NCBI-GeneID: 694117
NCBI-ProteinID: XP_014969500
Ensembl: ENSMMUG00000002692
UniProt: I0FMH5
LinkDB
Position
14
AA seq 575 aa
MTSKKLVNSVAGCADDALAGLVACNPNLQLLQGHRVALRSDLDSLKGRVALLSGGGSGHE
PAHAGFIGKGMLTGVIAGAVFTSPAVGSILAAIRAVAQAGTVGTLLIVKNYTGDRLNFGL
AREQARAEGIPVEMVVIGDDSAFTVLKKAGRRGLCGTVLIHKVAGALAEAGVGLEEITKR
VNVVAKAMGTLGVSLSSCSVPGSKPTFELSADEVELGLGIHGEAGVRRIKMATADEIVKL
MLDHMTDTTNASHVPVQPGSSVVMMVNNLGGLSFLELGIIADAAVRSLEGRGVKIARALV
GTFMSALEMPGISLTLLLVDEPLLKLIDAETTAVAWPNVAAVSITGRKRNRVAPAEPQEA
LDSTAVGGSASKRMALVLERVCSTLLGLEEHLNALDRAAGDGDCGTTHSRAARAIREWLK
EGPPPASPAQLLSKLSVLLLEKMGGSSGALYGLFLTAAAQPLKVKTSLPAWSAAMDAGLE
AMQKYGKAAPGDRTMLDSLWAAGQELQAWKSPGADLLQVLTKAVKSAEAAAEATKNMEAG
AGRASYISSARLEQPDPGAVAAAAILRAILEVLQN
NT seq 1728 nt   +upstreamnt  +downstreamnt
atgacctccaagaagctggtgaactcggtggctggctgtgctgatgacgcccttgctggc
ctggtggcctgcaaccccaacctgcagctcctgcagggccaccgcgtggccctccgttct
gacctggacagcctcaagggccgggtggcactgctatcgggtgggggctctggccatgag
cctgcccatgctggtttcatagggaaggggatgctgaccggggtcatcgcaggagccgta
ttcacctccccagcagtgggcagcatcctggcagccatcagggcagtggcccaggctggc
acagtggggaccctcctcatcgtgaagaactacactggggatcggctcaacttcggcctg
gccagggagcaggcccgggctgaaggcatcccggtggagatggtggtgatcggggatgac
agcgccttcaccgtcctgaagaaggcaggccggcgggggctgtgtggcacggtgcttata
cacaaggtggcaggtgctctggctgaggcaggtgtggggctggaggagatcacaaagcgg
gtgaacgtggtcgccaaggccatgggtaccctgggggtgagcttatcctcctgcagcgtc
cctggttccaaacccaccttcgagctctcggccgatgaggtggagctgggcctggggatc
cacggggaagctggtgtgcgccggataaagatggcaactgctgatgagattgtgaaactc
atgctcgaccacatgacagacaccaccaatgcgtcccatgtgcctgtgcagcccggctct
tcagttgtgatgatggtcaacaacctgggtggcctgtcattcctggaattgggcatcata
gccgatgctgccgttcgctccctggagggccgcggggtgaagattgcccgtgccctggtg
ggcaccttcatgtcagcactggagatgcctggcatttctctcaccctcctgctggtggat
gagcctctcctgaaactgatagatgctgaaaccactgcagtagcctggcctaacgtggcc
gcagtctccattactgggcggaagcggaaccgggtagcccctgccgagccccaggaggcc
cttgattccactgctgtaggaggctcagcctcgaagcggatggcgctggtgctggaacgg
gtgtgcagcaccctcctgggcctggaggaacacctgaatgccctggaccgggctgctggt
gatggcgactgtggcaccacccacagccgtgcggccagagcaatccgggagtggctgaag
gagggcccaccccctgccagccctgcccagctgctctccaagttgtctgtcctgctcctg
gagaagatgggaggctcatctggagcgctctatggcctgttcctgactgcagctgcccag
cccctcaaggtcaagaccagcctcccagcctggtctgctgccatggatgccggcctggaa
gccatgcagaagtatggaaaggctgccccaggggacaggactatgctggattctctgtgg
gcagcagggcaggagctccaagcctggaagagcccaggagccgatctgttgcaagtcctg
accaaagcagtcaagagtgccgaagctgcagcggaggccaccaagaatatggaagctgga
gccggaagagccagttatatcagctcagcacggctggagcagccagaccccggggcagtg
gcagctgctgccatcctccgggccatcctggaggtcttgcagaactag

DBGET integrated database retrieval system