KEGG   Macaca mulatta (rhesus monkey): 694181
Entry
694181            CDS       T01028                                 

Gene name
DRD2
Definition
(RefSeq) D(2) dopamine receptor
  KO
K04145  dopamine receptor D2
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04015  Rap1 signaling pathway
mcc04024  cAMP signaling pathway
mcc04080  Neuroactive ligand-receptor interaction
mcc04540  Gap junction
mcc04728  Dopaminergic synapse
mcc05012  Parkinson disease
mcc05030  Cocaine addiction
mcc05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    694181 (DRD2)
   04024 cAMP signaling pathway
    694181 (DRD2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    694181 (DRD2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    694181 (DRD2)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    694181 (DRD2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    694181 (DRD2)
  09165 Substance dependence
   05030 Cocaine addiction
    694181 (DRD2)
   05034 Alcoholism
    694181 (DRD2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mcc04030]
    694181 (DRD2)
G protein-coupled receptors [BR:mcc04030]
 Rhodopsin family
  Biogenic amine
   Dopamine
    694181 (DRD2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srv DUF2207
Other DBs
NCBI-GeneID: 694181
NCBI-ProteinID: XP_001085571
Ensembl: ENSMMUG00000014334
UniProt: F7CYH8
LinkDB
Position
14
AA seq 443 aa
MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVS
REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTA
SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMIAIVWVLSFTISCPLLFGLNNADQN
ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRSHLRAPL
KGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPP
SHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKNHPKIAKIFEIQTMPNGKTRTSLKTMSR
RKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSA
VNPIIYTTFNIEFRKAFLKILHC
NT seq 1332 nt   +upstreamnt  +downstreamnt
atggatccactgaatctgtcctggtacgatgatgatctggagaggcagaactggagccgg
cccttcaacgggtcggacgggaaggcggacagaccccactacaactactatgccacgctg
ctcaccctgctcatcgcggtcatcgtcttcggcaacgtgctggtgtgcatggccgtgtcc
cgcgagaaggcgctgcagaccaccaccaactacctgatcgtcagcctcgcggtggccgac
ctcctcgtggccacactggtcatgccctgggttgtctacctggaggtggtaggtgagtgg
aaattcagcaggattcactgtgacatcttcgtcactctggacgtcatgatgtgcacggcg
agcattctgaacttgtgtgccatcagcatcgacaggtacacagctgtggccatgcccatg
ctgtacaatacgcgctacagctccaagcgccgggtcaccgtcatgatcgccatcgtctgg
gtcctgtccttcaccatctcctgtccactcctcttcggactcaacaacgcagaccagaac
gagtgcatcattgccaacccggccttcgtggtctactcctccatcgtctccttctacgtg
cccttcatcgtcaccctgctggtctacatcaagatctacattgtcctccgcagacgccgc
aagcgagtcaacacgaagcgcagcagccgagccttcaggtcccacctgagggctccacta
aagggcaactgtactcaccccgaggacatgaaactctgcaccgttatcatgaagtctaat
gggagtttcccagtgaacaggcggagagtggaggctgcccggcgagcccaggagctggag
atggagatgctctccagcaccagcccacccgagaggacccggtacagccccatcccgccc
agccaccaccagctgactctccccgacccgtcccaccacggtctccacagcactcctgac
agccccgccaaaccagagaagaacgggcatgccaaaaaccaccccaagattgccaagata
tttgagatccagaccatgcccaatggcaaaacccggacctccctcaagaccatgagccgt
aggaagctctcccagcagaaggagaagaaagccactcagatgctcgccattgttctcggc
gtgttcatcatctgctggctgcccttcttcatcacacacatcctgaacatacactgtgac
tgcaacatcccgcctgtcctgtacagcgccttcacgtggctgggctatgtcaacagcgcc
gtgaaccccatcatctacaccaccttcaacattgagttccgcaaggccttcctgaagatc
ctccactgctga

DBGET integrated database retrieval system