KEGG   Macaca mulatta (rhesus monkey): 694353
Entry
694353            CDS       T01028                                 

Gene name
TMEM173
Definition
(RefSeq) stimulator of interferon genes protein
  KO
K12654  transmembrane protein 173
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04621  NOD-like receptor signaling pathway
mcc04622  RIG-I-like receptor signaling pathway
mcc04623  Cytosolic DNA-sensing pathway
mcc05163  Human cytomegalovirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    694353 (TMEM173)
   04622 RIG-I-like receptor signaling pathway
    694353 (TMEM173)
   04623 Cytosolic DNA-sensing pathway
    694353 (TMEM173)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    694353 (TMEM173)
   05171 Coronavirus disease - COVID-19
    694353 (TMEM173)
   05168 Herpes simplex virus 1 infection
    694353 (TMEM173)
   05163 Human cytomegalovirus infection
    694353 (TMEM173)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    694353 (TMEM173)
Membrane trafficking [BR:mcc04131]
 Autophagy
  Xenophagy
   Other xenophagy associated proteins
    694353 (TMEM173)
SSDB
Motif
Pfam: TMEM173 Flavi_NS4B
Other DBs
NCBI-GeneID: 694353
NCBI-ProteinID: XP_014996496
Ensembl: ENSMMUG00000012048
UniProt: H9YZQ6
LinkDB
Position
6
AA seq 379 aa
MTRSSLHPSIPCPRGHGAQKAALVLLTACLGTLWGLGESPEHILRCLVLHLASLQLGQLL
NGVCSLAEELRHIHSRYRDSYWRTVRACLGCPFHRGTLLLLSGYFYYSLPNAVGLPFTWM
LALLGLSQALNILLGLKGLTPAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPGLQARIQ
TYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTADRAGIKDRVY
SNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYGQAGFSREDRLEQVKLFCRTLEDILA
DNPESQNNCRLIVYSEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKNSAVPSTSTMSQE
PELLISGMEKPLPLRTDFS
NT seq 1140 nt   +upstreamnt  +downstreamnt
atgacccgctccagtctgcatccatccatcccgtgtcccaggggtcacggggcccagaag
gcagccttggttctgctgactgcctgcctggggaccctttgggggctaggagagtcacca
gagcacattctccggtgcctggtgctccacctagcctccctgcagctgggacagctgtta
aatggggtctgcagcctggctgaggagctgcgccacatccactccaggtaccgggacagc
tactggaggactgtgcgggcctgcctgggctgcccattccaccgtgggaccctgttgctg
ctgtccggctatttctactattcccttccaaatgcggtcggcctgcccttcacttggatg
cttgccctcctgggcctttcgcaggcactgaacatcctcttgggcctcaagggcctgacc
ccagctgagatctctgcagtctgtgaaaaagggaatttcaacgtggcccatgggctggca
tggtcatattacattggatatctgcggctgatcctgccaggactccaggcccggattcaa
acttacaatcagcattacaacaacctgctacggggtgcagtgagccagcggctgtatatc
ctcctcccgttggactgtggggtgcctgataacctgagtatggctgatcccaacattcgc
ttcctggataaactgccccagcagaccgctgaccgtgctggcatcaaagatagggtttac
agcaacagcatctatgagcttctggagaacgggcagcgggcaggcacctgtgtcctggag
tacgccacccccttgcagactttgtttgccatgtcacaatatggtcaagctggatttagc
cgggaggatcggcttgagcaggtcaaactcttctgccggacactggaggacatcctggca
gataaccctgagtctcagaacaactgccgcctcattgtctactcggaacctgcagatgac
agcagcttctcgctgtcccaagaggttctccggcacctgcggcaggaggaaaaggaagag
gttactgtgggcagcttgaagaactcagcggtgcccagtacctccacaatgtcccaagag
cctgagctcctcatcagcggaatggaaaagcccctccctctccgcacggatttctcctga

DBGET integrated database retrieval system