KEGG   Macaca mulatta (rhesus monkey): 694544
Entry
694544            CDS       T01028                                 

Gene name
CASP9
Definition
(RefSeq) caspase-9
  KO
K04399  caspase 9 [EC:3.4.22.62]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01524  Platinum drug resistance
mcc04115  p53 signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04210  Apoptosis
mcc04215  Apoptosis - multiple species
mcc04370  VEGF signaling pathway
mcc04919  Thyroid hormone signaling pathway
mcc05010  Alzheimer disease
mcc05012  Parkinson disease
mcc05014  Amyotrophic lateral sclerosis
mcc05016  Huntington disease
mcc05020  Prion disease
mcc05022  Pathways of neurodegeneration - multiple diseases
mcc05134  Legionellosis
mcc05145  Toxoplasmosis
mcc05152  Tuberculosis
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05162  Measles
mcc05163  Human cytomegalovirus infection
mcc05164  Influenza A
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05200  Pathways in cancer
mcc05210  Colorectal cancer
mcc05212  Pancreatic cancer
mcc05213  Endometrial cancer
mcc05215  Prostate cancer
mcc05222  Small cell lung cancer
mcc05223  Non-small cell lung cancer
mcc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    694544 (CASP9)
   04151 PI3K-Akt signaling pathway
    694544 (CASP9)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    694544 (CASP9)
   04215 Apoptosis - multiple species
    694544 (CASP9)
   04115 p53 signaling pathway
    694544 (CASP9)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    694544 (CASP9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    694544 (CASP9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    694544 (CASP9)
   05212 Pancreatic cancer
    694544 (CASP9)
   05215 Prostate cancer
    694544 (CASP9)
   05213 Endometrial cancer
    694544 (CASP9)
   05222 Small cell lung cancer
    694544 (CASP9)
   05223 Non-small cell lung cancer
    694544 (CASP9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    694544 (CASP9)
   05012 Parkinson disease
    694544 (CASP9)
   05014 Amyotrophic lateral sclerosis
    694544 (CASP9)
   05016 Huntington disease
    694544 (CASP9)
   05020 Prion disease
    694544 (CASP9)
   05022 Pathways of neurodegeneration - multiple diseases
    694544 (CASP9)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    694544 (CASP9)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    694544 (CASP9)
   05152 Tuberculosis
    694544 (CASP9)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    694544 (CASP9)
   05161 Hepatitis B
    694544 (CASP9)
   05160 Hepatitis C
    694544 (CASP9)
   05164 Influenza A
    694544 (CASP9)
   05162 Measles
    694544 (CASP9)
   05168 Herpes simplex virus 1 infection
    694544 (CASP9)
   05163 Human cytomegalovirus infection
    694544 (CASP9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    694544 (CASP9)
   05169 Epstein-Barr virus infection
    694544 (CASP9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    694544 (CASP9)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    694544 (CASP9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcc01009]
    694544 (CASP9)
   01002 Peptidases and inhibitors [BR:mcc01002]
    694544 (CASP9)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.62  caspase-9
     694544 (CASP9)
Protein phosphatases and associated proteins [BR:mcc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     694544 (CASP9)
Peptidases and inhibitors [BR:mcc01002]
 Cysteine peptidases
  Family C14: caspase family
   694544 (CASP9)
SSDB
Motif
Pfam: Peptidase_C14 CARD CARD_2
Other DBs
NCBI-GeneID: 694544
NCBI-ProteinID: XP_001082859
Ensembl: ENSMMUG00000018163
UniProt: I0FVL9
LinkDB
Position
1
AA seq 416 aa
MDEADRRLLRRCRLRLVEELQVDQLWDALLSRELFKPHMIEDIQRAGSGSRRDQARQLIT
DLETRGSQALPSFISCLVDTGQDMLASFLRTNRQAVKLSKPTLENLTPVVLRPEIRKPEV
LRPETPRPVDIGSGGFGDVGAPESLRGNADLAYVLSMEPCGHCLIINNVNFCRESGLSTR
TGSSIDCEKLQRRFSLLHFMVEVKHDLTAKEMVLALLELARRDHSALDCCVVVILSHGCQ
ASHLQFPGAVYGTDGCPVSVERIVNIFNGTSCPSLGGKPKLFFIQACGGEQKDHGFEVAS
TSPEDESSGSNPEPDATPFQEDLRTFDQLDAVSSLPTPSDIFVSYSTFPGFVSLRDPKSG
SWYIETLDNIFEQWAHSEDLQSLLLRVADAVSVKGIYKQMPGCFNFLRKKLFFKTS
NT seq 1251 nt   +upstreamnt  +downstreamnt
atggatgaagcggaccggcggctcctgcggcggtgccggctgcggctggtggaggagctg
caggtggatcagctctgggacgccctgctgagccgcgagctgttcaagccccacatgatc
gaggacatccagcgggcaggctctggatctcggcgggatcaggccaggcaactgatcaca
gatctagagactcgagggagtcaagctcttccttcgttcatctcctgcttagtggacaca
ggccaggacatgttggcttcgttcctgcgaactaacaggcaagcagtaaagttgtcgaag
ccaaccctagaaaaccttaccccggtggtgctcagaccagagattcgcaaaccagaggtt
ctcagaccggaaacacccagaccagtggacattggttctggaggattcggtgatgttggt
gctcctgagagtttgaggggaaatgcagatttggcttacgtcctgagcatggagccctgt
ggccactgcctcattatcaacaatgtgaacttctgccgtgagtctgggctcagcacccgc
actggctccagcattgactgtgagaagttgcagcgccgcttctctttgctgcatttcatg
gtggaggtgaagcacgacctgactgccaaggaaatggtgctagctttgctggagctggca
cggcgggaccacagtgctctggactgctgtgtggtggtcattctctctcacggctgtcag
gccagccacctgcagttcccaggggctgtctacggcacagatggatgccctgtgtcggtc
gagaggattgtgaacatcttcaatgggaccagctgccccagcctgggagggaagcccaag
ctctttttcatccaggcctgtggtggggagcagaaagaccatgggtttgaggtggcctcc
acctcccctgaagacgagtcctctggcagtaaccccgagccagacgccaccccgttccag
gaagatttgaggaccttcgaccagctggacgctgtatctagtttgcccacacccagcgac
atctttgtgtcctactctactttcccgggttttgtctccttgagggaccccaagagtggc
tcctggtacattgagaccctggacaacatctttgagcagtgggctcactctgaagacctg
cagtccctcctgctcagggtcgctgatgctgtttcggtgaaagggatttataaacagatg
cctggttgctttaatttcctccggaaaaagcttttctttaaaacatcgtaa

DBGET integrated database retrieval system