KEGG   Macaca mulatta (rhesus monkey): 694560
Entry
694560            CDS       T01028                                 

Gene name
TCF7L1
Definition
(RefSeq) transcription factor 7-like 1 isoform X2
  KO
K04490  transcription factor 7-like 1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04310  Wnt signaling pathway
mcc04390  Hippo signaling pathway
mcc04520  Adherens junction
mcc04916  Melanogenesis
mcc04934  Cushing syndrome
mcc05132  Salmonella infection
mcc05165  Human papillomavirus infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05200  Pathways in cancer
mcc05210  Colorectal cancer
mcc05213  Endometrial cancer
mcc05215  Prostate cancer
mcc05216  Thyroid cancer
mcc05217  Basal cell carcinoma
mcc05221  Acute myeloid leukemia
mcc05224  Breast cancer
mcc05225  Hepatocellular carcinoma
mcc05226  Gastric cancer
mcc05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    694560 (TCF7L1)
   04390 Hippo signaling pathway
    694560 (TCF7L1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    694560 (TCF7L1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    694560 (TCF7L1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    694560 (TCF7L1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    694560 (TCF7L1)
   05225 Hepatocellular carcinoma
    694560 (TCF7L1)
   05226 Gastric cancer
    694560 (TCF7L1)
   05216 Thyroid cancer
    694560 (TCF7L1)
   05221 Acute myeloid leukemia
    694560 (TCF7L1)
   05217 Basal cell carcinoma
    694560 (TCF7L1)
   05215 Prostate cancer
    694560 (TCF7L1)
   05213 Endometrial cancer
    694560 (TCF7L1)
   05224 Breast cancer
    694560 (TCF7L1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    694560 (TCF7L1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    694560 (TCF7L1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    694560 (TCF7L1)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    694560 (TCF7L1)
   05165 Human papillomavirus infection
    694560 (TCF7L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcc03000]
    694560 (TCF7L1)
Transcription factors [BR:mcc03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    694560 (TCF7L1)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 694560
NCBI-ProteinID: XP_001083116
Ensembl: ENSMMUG00000020134
LinkDB
Position
13
AA seq 589 aa
MPQLGGGGGGGGGGGSGGGSGSSAGAAGGGDDLGANDELIPFQDEGSEEQEPSSDSASAQ
RDLDEVKSSLVNESENQSSSSDSEAERRPQPARDTFQKPRDYFADVRRPQDSAFFKGPPY
PGYPFLMIPDLSSPYLSNGPLSPGGARTYLQMKWPLLDVPSSATVKDTRSPSPAHLSNKV
PVVQHPHHMHPLTPLITYSNDHFSPGSPPTHLSPEIDPKTGIPRPPHPSELSPYYPLSPG
AVGQIPHPLGWLVPQQGQPVYSLPPGGFRHPYPALAMNASMSSLVSSRFSPHMVAPAHPG
LPTSGIPHPAIVSPIVKQEPAPPSLSPAVSAKSPVTVKKEEEKKPHVKKPLNAFMLYMKE
MRAKVVAECTLKESAAINQILGRKWHNLSREEQAKYYELARKERQLHSQLYPTWSARDNY
GKKKKRKREKQLSQTQPQQQVQEAEGALASKSKKPCVQYLPPEKPCDSPASSHGSMLDSP
ATPSAALASPAAPAATHSEQAQPLSLTTKPETRAQLALHSAAFLSAKAAASSSGQMGSQP
PLLSRPLPLGSMPTALLASPPSFPATLHAHQALPVLQAQPLSLVTKSAH
NT seq 1770 nt   +upstreamnt  +downstreamnt
atgccccagctcggcggcgggggcggcgggggcggcggcggcggcagcgggggaggcagt
ggctccagcgccggggcagcaggcggaggggacgacctcggggcgaacgacgagctgatc
cccttccaggacgaggggagcgaggagcaggagccgagcagcgacagcgcctcggcgcag
cgggacctagacgaggtcaagtcgtccctggtcaacgagtcggagaaccagagcagcagc
tcggactcggaggctgagaggcgcccgcagcccgcccgggacactttccagaagccgcgg
gactatttcgccgatgtgagaaggccccaggacagcgcgttctttaaaggacccccatac
cctgggtaccccttcctgatgatcccggacctgagcagcccgtacctctccaacggaccc
ctgtctcccggaggagcgcgcacctacctgcagatgaaatggcccctcctcgatgtcccc
tccagcgccacagtcaaggacacaaggtcaccatctccagcacacttgtccaataaagtt
cctgtcgttcaacacccgcatcacatgcatccactgactccgctcatcacctacagcaat
gaccacttctcccccggctcccctcccacccacctctccccagagatcgatccaaagaca
ggaatcccccggccccctcacccatccgagctgtcaccgtattacccactctctcccgga
gctgtcggacaaatcccccaccccctcggctggctcgtcccacagcaaggccagcccgtg
tactcccttccccctggtggcttccggcacccttaccccgccctcgccatgaacgcctcg
atgtccagcctggtctccagtcggttctctcctcacatggtggctcctgcccaccctggc
ctgcccacctcagggatcccccaccctgccatcgtctcccccatcgtcaagcaggaaccg
gcaccccccagcctgagccctgcagtgagcgcgaaatcaccagtcaccgtgaaaaaggag
gaagaaaagaagccccacgtgaagaagcctctgaatgccttcatgttgtatatgaaggag
atgagagccaaggtggtggctgagtgcaccctgaaggaaagtgcggccattaaccagatc
ctgggaagaaagtggcacaacctgtctcgagaagaacaggccaagtactacgagctggcc
cggaaggagcggcagcttcactcgcagctctacccgacctggtcagcccgggacaactac
ggtaagaaaaagaagaggaagagagaaaagcagctgtcccagacacagccacagcagcaa
gtccaggaggcagagggtgctctggcctccaagagcaagaagccatgtgttcagtacctg
ccccccgagaagccctgtgacagccctgcctcctcccacgggagcatgctggactccccg
gccaccccctctgcagcgttggcctcaccagctgcccctgctgccacccattcggagcaa
gcccagcccctctccctcaccaccaaaccagaaacccgggcccagctggctctccactct
gctgccttcctgtcagctaaggctgcagcctcctcctctggccagatgggcagccagcct
cccctcctgtcccggcccctcccccttgggtccatgcccacagctctgctggcctctccc
ccgtcctttcccgccacactccatgcccaccaggccctcccggtgctacaggcccagcct
ctttccctggtcaccaagtctgcccactaa

KEGG   Macaca mulatta (rhesus monkey): 695776
Entry
695776            CDS       T01028                                 

Gene name
LEF1
Definition
(RefSeq) lymphoid enhancer-binding factor 1 isoform X3
  KO
K04492  lymphoid enhancer-binding factor 1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04310  Wnt signaling pathway
mcc04390  Hippo signaling pathway
mcc04520  Adherens junction
mcc04916  Melanogenesis
mcc04934  Cushing syndrome
mcc05132  Salmonella infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05200  Pathways in cancer
mcc05210  Colorectal cancer
mcc05213  Endometrial cancer
mcc05215  Prostate cancer
mcc05216  Thyroid cancer
mcc05217  Basal cell carcinoma
mcc05221  Acute myeloid leukemia
mcc05224  Breast cancer
mcc05225  Hepatocellular carcinoma
mcc05226  Gastric cancer
mcc05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    695776 (LEF1)
   04390 Hippo signaling pathway
    695776 (LEF1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    695776 (LEF1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    695776 (LEF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    695776 (LEF1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    695776 (LEF1)
   05225 Hepatocellular carcinoma
    695776 (LEF1)
   05226 Gastric cancer
    695776 (LEF1)
   05216 Thyroid cancer
    695776 (LEF1)
   05221 Acute myeloid leukemia
    695776 (LEF1)
   05217 Basal cell carcinoma
    695776 (LEF1)
   05215 Prostate cancer
    695776 (LEF1)
   05213 Endometrial cancer
    695776 (LEF1)
   05224 Breast cancer
    695776 (LEF1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    695776 (LEF1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    695776 (LEF1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    695776 (LEF1)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    695776 (LEF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcc03000]
    695776 (LEF1)
Transcription factors [BR:mcc03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    695776 (LEF1)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 695776
NCBI-ProteinID: XP_001086645
Ensembl: ENSMMUG00000023256
LinkDB
Position
5
AA seq 386 aa
MPQLSGGGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNE
SEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNM
NNDPYMSNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHIPSDVNS
KQGMSRHPPAPDIPTFYPLSPGGVGQITPPLGWFSHHMIPGPPGPHTTGIPHPAIVTPQV
KQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAA
INQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKREKLQESTS
GGKRSSFPTCKAKAATPGPLLEMEAC
NT seq 1161 nt   +upstreamnt  +downstreamnt
atgccccaactctccggaggaggtggcggcggcgggggggacccggaactctgcgccact
gacgagatgatccccttcaaggacgagggcgatcctcagaaggaaaagatcttcgccgag
atcagtcaccctgaagaggaaggcgatttagctgacatcaagtcctccttggtgaacgag
tctgaaatcatcccagccagcaacggacacgaggtggccagacaagcacaaacctctcag
gagccctaccacgacaaggccagagaacaccccgatgacggaaagcatccagatggaggc
ctctacaacaagggaccctcctactcgagttattccgggtacataatgatgccaaatatg
aataacgacccatacatgtcaaatggatctctttctccacccatcccgagaacatcaaat
aaagtgcccgtggtgcagccatcccatgcagtccatcctctcactcccctcatcacttac
agtgacgagcacttttctccaggatcacacccgtcacacatcccatcagatgtcaactcc
aaacaaggcatgtccagacatcctccagctcctgatatccctactttttatcccctgtct
ccgggtggtgttggacagatcaccccacctcttggctggttttctcatcatatgattccc
ggtcctcctggtccccacacaactggcatccctcatccagctattgtaacacctcaggtc
aaacaggaacatccccacactgacagtgacctaatgcacgtgaagcctcagcatgaacag
agaaaggagcaggagccaaaaagacctcacattaagaagcctctgaatgcttttatgtta
tacatgaaagaaatgagagcgaatgtcgtcgctgagtgtactctaaaagaaagtgcagct
atcaaccagattctcggcagaaggtggcatgccctctcccgtgaagagcaggctaaatat
tatgaattagcacggaaagaaagacagctacatatgcaactttatccaggctggtctgca
agagacaattatggtaagaaaaagaagaggaagagagagaaactacaggaatctacatca
ggtggaaaacgaagctcattcccaacgtgcaaagccaaggcagcgaccccaggacctctt
ctggagatggaagcttgttga

KEGG   Macaca mulatta (rhesus monkey): 701759
Entry
701759            CDS       T01028                                 

Gene name
TCF7L2
Definition
(RefSeq) transcription factor 7-like 2 isoform X9
  KO
K04491  transcription factor 7-like 2
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04310  Wnt signaling pathway
mcc04390  Hippo signaling pathway
mcc04520  Adherens junction
mcc04916  Melanogenesis
mcc04934  Cushing syndrome
mcc05132  Salmonella infection
mcc05165  Human papillomavirus infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05200  Pathways in cancer
mcc05210  Colorectal cancer
mcc05213  Endometrial cancer
mcc05215  Prostate cancer
mcc05216  Thyroid cancer
mcc05217  Basal cell carcinoma
mcc05221  Acute myeloid leukemia
mcc05224  Breast cancer
mcc05225  Hepatocellular carcinoma
mcc05226  Gastric cancer
mcc05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    701759 (TCF7L2)
   04390 Hippo signaling pathway
    701759 (TCF7L2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    701759 (TCF7L2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    701759 (TCF7L2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    701759 (TCF7L2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    701759 (TCF7L2)
   05225 Hepatocellular carcinoma
    701759 (TCF7L2)
   05226 Gastric cancer
    701759 (TCF7L2)
   05216 Thyroid cancer
    701759 (TCF7L2)
   05221 Acute myeloid leukemia
    701759 (TCF7L2)
   05217 Basal cell carcinoma
    701759 (TCF7L2)
   05215 Prostate cancer
    701759 (TCF7L2)
   05213 Endometrial cancer
    701759 (TCF7L2)
   05224 Breast cancer
    701759 (TCF7L2)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    701759 (TCF7L2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    701759 (TCF7L2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    701759 (TCF7L2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    701759 (TCF7L2)
   05165 Human papillomavirus infection
    701759 (TCF7L2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcc03000]
    701759 (TCF7L2)
Transcription factors [BR:mcc03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    701759 (TCF7L2)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 701759
NCBI-ProteinID: XP_015003683
Ensembl: ENSMMUG00000022799
LinkDB
Position
9
AA seq 649 aa
MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVNESETNQNSSS
DSEAERRPPPRSESFRDKSRESLEEAAKRQDGGLFKGPPYPGYPFIMIPDLTSPYLPNGS
LSPTARTYLQMKWPLLDVQAGSLQSRQALKDARSPSPAHIVQSPLPCCTQGHDCQHFYPP
SDFTVSTQVFRDMKRSHSLQKVGEPWCIESNKVPVVQHPHHVHPLTPLITYSNEHFTPGN
PPPHLPADVDPKTGIPRPPHPPDISPYYPLSPGTVGQIPHPLGWLVPQQGQPVYPITTGG
FRHPYPTALTVNASMSSFLSSRFPPHMVPPHHTLHTTGIPHPAIVTPTVKQESSQSDVGS
LHSSKHQDSKKEEEKKKPHIKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHA
LSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKRDKQPGETNEHSECFLNPCL
SLPPITDLSAPKKCRARFGLDQQNNWCGPCRRKKKCVRYIQGEGSCLSPPSSDGSLLDSP
PPSPNLLGSPPRDAKSQTEQTQPLSLSLKPDPLAHLSMMPPPPALLLAEATHKASALCPN
GALDLPPTALQPAAPSSSVAQPSTSSLHSHSSLAGTQPQPLSLVTKSLE
NT seq 1950 nt   +upstreamnt  +downstreamnt
atgccgcagctgaacggcggtggaggggatgacctaggcgccaacgacgaactgatttcc
ttcaaagacgagggcgaacaggaggagaagagctccgaaaactcctcggcagagagggat
ttagctgatgtcaaatcgtctctagtcaatgaatcagaaacgaatcaaaacagctcctcc
gattccgaggcggaaagacggcctccgcctcgctccgaaagtttccgagataaatcccgg
gaaagtttggaagaagcggccaagaggcaagatggagggctctttaaggggccaccgtat
cccggctaccccttcatcatgatccccgacctgacgagcccctacctccccaacggatcg
ctctcgcccaccgcccgaacctatctccagatgaaatggccactgcttgatgtccaggca
gggagcctgcagagtagacaagctctcaaggatgctcggtccccatcgccggcacacatt
gtccagagccccctcccttgctgcactcagggacatgactgtcagcacttctaccccccc
tcagacttcactgtcagcactcaagtcttcagggacatgaaaaggagccactccttacaa
aaagttggggagccctggtgtattgagtcgaacaaagtgccagtggtgcagcaccctcac
catgtccaccccctcacgcctcttatcacctacagcaatgaacacttcacgccgggaaac
ccacctccacacttaccagccgacgtagaccccaaaacaggaatcccacggcctccgcac
cctccagatatatccccgtattacccgctatcgcctggcaccgtaggacaaatcccccat
ccgctaggatggttagtaccacagcaaggtcaaccagtgtacccaatcacgacaggagga
ttcagacacccctaccccacagctctgactgtcaatgcttccatgtccagctttctgtct
tctaggttccctccccatatggtcccaccacatcatacgctacacacgacgggcattccg
catccggccatagtcacaccaacagtcaaacaggaatcgtcccagagtgacgtcggctca
ctccatagctcaaagcatcaggactccaaaaaggaagaagaaaagaagaagccccacata
aagaaacctcttaatgcattcatgttgtatatgaaggaaatgagagcaaaggtcgtagct
gagtgcacgttgaaagaaagcgcggccatcaaccagatccttgggcggaggtggcacgca
ctgtccagagaagagcaagcgaaatactatgagctggcccggaaggagcgacagcttcat
atgcagctgtaccccggctggtccgcgcgggataactatggaaagaagaagaagaggaaa
agggacaagcagccgggagagaccaatgaacacagcgaatgtttcctaaatccttgcctt
tcacttcctccgattacagacctgagcgctcctaagaaatgccgagcgcgctttggcctt
gatcaacagaataactggtgcggcccttgcaggagaaaaaaaaagtgcgttcgctacata
caaggtgaaggcagctgcctcagcccaccctcttcagatggaagcttactagattcgcct
cccccctcccccaacctgctaggctcccctccccgagacgccaagtcacagactgagcag
acccagcctctgtcgctgtccctgaagcccgaccccctggcccacctgtccatgatgcct
ccgccgcccgccctcctgctcgccgaggccacccacaaggcctccgccctctgtcccaac
ggggccctggacctgcccccaaccgctttgcagcctgccgccccctcctcatcagttgca
cagccgtcgacttcttccttacattcccacagctccctggccgggacccagccccagccg
ctgtcgctcgtcaccaagtctttagaatag

KEGG   Macaca mulatta (rhesus monkey): 710234
Entry
710234            CDS       T01028                                 

Gene name
TCF7
Definition
(RefSeq) transcription factor 7 isoform X3
  KO
K02620  transcription factor 7
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04310  Wnt signaling pathway
mcc04390  Hippo signaling pathway
mcc04520  Adherens junction
mcc04550  Signaling pathways regulating pluripotency of stem cells
mcc04916  Melanogenesis
mcc04934  Cushing syndrome
mcc05132  Salmonella infection
mcc05165  Human papillomavirus infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05200  Pathways in cancer
mcc05210  Colorectal cancer
mcc05213  Endometrial cancer
mcc05215  Prostate cancer
mcc05216  Thyroid cancer
mcc05217  Basal cell carcinoma
mcc05221  Acute myeloid leukemia
mcc05224  Breast cancer
mcc05225  Hepatocellular carcinoma
mcc05226  Gastric cancer
mcc05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    710234 (TCF7)
   04390 Hippo signaling pathway
    710234 (TCF7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    710234 (TCF7)
   04550 Signaling pathways regulating pluripotency of stem cells
    710234 (TCF7)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    710234 (TCF7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    710234 (TCF7)
  09162 Cancer: specific types
   05210 Colorectal cancer
    710234 (TCF7)
   05225 Hepatocellular carcinoma
    710234 (TCF7)
   05226 Gastric cancer
    710234 (TCF7)
   05216 Thyroid cancer
    710234 (TCF7)
   05221 Acute myeloid leukemia
    710234 (TCF7)
   05217 Basal cell carcinoma
    710234 (TCF7)
   05215 Prostate cancer
    710234 (TCF7)
   05213 Endometrial cancer
    710234 (TCF7)
   05224 Breast cancer
    710234 (TCF7)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    710234 (TCF7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    710234 (TCF7)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    710234 (TCF7)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    710234 (TCF7)
   05165 Human papillomavirus infection
    710234 (TCF7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcc03000]
    710234 (TCF7)
Transcription factors [BR:mcc03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    710234 (TCF7)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2 Peptidase_M13 MATalpha_HMGbox
Other DBs
NCBI-GeneID: 710234
NCBI-ProteinID: XP_014996400
Ensembl: ENSMMUG00000022788
LinkDB
Position
6
AA seq 418 aa
MPQLDSGGGGAGGGDDLGAPDELLAFQDEGEEQDDKIRDSAAGPERDLAELKSSLVNESE
GAAGGAGIPGVPGAGAGARGEAEVGAEALGREHAAQRLFPDKLPEPLEDGLKAPECTSGM
YKETVYSAFNLLMHYPPPSGAGQHPQPQPPLHKANQPPHGVPQLSLYDHFNSPHPTPAPA
DVSQKQVHRPLQTPDLSGFYSLTSGSMGQLPHTVSWPSPPLYPLSPSCGYRQHFPAPTAA
PGAPYPRFTHPSLMLGSSVPGHPAAIPHPAIVPPSGKQELQSFDRNLKTQAESKAEKEAK
KPTIKKPLNAFMLYMKEMRAKVIAECTLKESAAINQILGRRWHALSREEQAKYYELARKE
RQLHMQLYPGWSARDNYGKKKRRSREKHQESTTDPGSPKKCRARFGLNQQTDWCGPCR
NT seq 1257 nt   +upstreamnt  +downstreamnt
atgccgcagctggactcaggcgggggcggcgcgggcggcggcgacgacctcggcgcaccg
gacgagctgctggccttccaggatgagggcgaggagcaggacgacaagatccgcgacagc
gccgccggtcccgagcgcgacctcgccgagctcaagtcgtcgctcgtgaacgagtccgag
ggcgcggccggcggcgcagggatcccgggggtcccgggagccggcgccggggcccgcggc
gaggccgaggtcggggcggaggctctcgggcgggaacacgctgcgcagagactcttcccg
gacaaacttccagagcccctggaggacggcctgaaggccccggagtgtaccagcggcatg
tacaaagagaccgtctactccgccttcaatctgctcatgcactacccacccccctcggga
gcagggcagcacccccagccgcagcccccgctgcacaaggccaatcagcccccccatggt
gtcccccaactctctctctacgaccatttcaacagcccacaccccacccctgcacctgcg
gacgtcagccagaagcaagttcacaggcctctgcagacccctgacctctctggcttctac
tccctgacctcaggcagcatggggcagctcccccacactgtgagctggcccagccctcct
ctctaccccttgtccccttcctgcggatatagacagcacttccctgcccccactgcagcc
cctggcgccccctaccccaggttcacccacccgtccttgatgctaggttctagtgtacct
ggtcacccagcagccatcccccacccggccattgtgcccccctcagggaagcaggagctt
cagtccttcgaccgcaacctgaagacacaagcagagtccaaggcagagaaggaggccaag
aaaccaaccatcaagaagcccctcaatgccttcatgctgtacatgaaggagatgagagcc
aaggtcatcgcagagtgcacacttaaggagagtgctgccatcaaccagatcctgggccgc
aggtggcatgcgctgtcgcgagaagagcaggccaagtactatgagctggcccgcaaggag
aggcagctgcacatgcagctatacccaggctggtcagcgcgggacaactatgggaagaag
aagaggcggtcgagggaaaagcaccaagaatccaccacagaccctggctcgcctaagaaa
tgccgtgctcgctttggcctcaaccagcagacggattggtgtggtccgtgcagataa

DBGET integrated database retrieval system