KEGG   Macaca mulatta (rhesus monkey): 694626
Entry
694626            CDS       T01028                                 

Gene name
MYC
Definition
(RefSeq) myc proto-oncogene protein
  KO
K04377  Myc proto-oncogene protein
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04010  MAPK signaling pathway
mcc04012  ErbB signaling pathway
mcc04110  Cell cycle
mcc04151  PI3K-Akt signaling pathway
mcc04218  Cellular senescence
mcc04310  Wnt signaling pathway
mcc04350  TGF-beta signaling pathway
mcc04390  Hippo signaling pathway
mcc04550  Signaling pathways regulating pluripotency of stem cells
mcc04630  JAK-STAT signaling pathway
mcc04919  Thyroid hormone signaling pathway
mcc05132  Salmonella infection
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05163  Human cytomegalovirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05169  Epstein-Barr virus infection
mcc05200  Pathways in cancer
mcc05202  Transcriptional misregulation in cancer
mcc05205  Proteoglycans in cancer
mcc05206  MicroRNAs in cancer
mcc05210  Colorectal cancer
mcc05213  Endometrial cancer
mcc05216  Thyroid cancer
mcc05219  Bladder cancer
mcc05220  Chronic myeloid leukemia
mcc05221  Acute myeloid leukemia
mcc05222  Small cell lung cancer
mcc05224  Breast cancer
mcc05225  Hepatocellular carcinoma
mcc05226  Gastric cancer
mcc05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    694626 (MYC)
   04012 ErbB signaling pathway
    694626 (MYC)
   04310 Wnt signaling pathway
    694626 (MYC)
   04350 TGF-beta signaling pathway
    694626 (MYC)
   04390 Hippo signaling pathway
    694626 (MYC)
   04630 JAK-STAT signaling pathway
    694626 (MYC)
   04151 PI3K-Akt signaling pathway
    694626 (MYC)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    694626 (MYC)
   04218 Cellular senescence
    694626 (MYC)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    694626 (MYC)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    694626 (MYC)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    694626 (MYC)
   05202 Transcriptional misregulation in cancer
    694626 (MYC)
   05206 MicroRNAs in cancer
    694626 (MYC)
   05205 Proteoglycans in cancer
    694626 (MYC)
   05230 Central carbon metabolism in cancer
    694626 (MYC)
  09162 Cancer: specific types
   05210 Colorectal cancer
    694626 (MYC)
   05225 Hepatocellular carcinoma
    694626 (MYC)
   05226 Gastric cancer
    694626 (MYC)
   05216 Thyroid cancer
    694626 (MYC)
   05221 Acute myeloid leukemia
    694626 (MYC)
   05220 Chronic myeloid leukemia
    694626 (MYC)
   05219 Bladder cancer
    694626 (MYC)
   05213 Endometrial cancer
    694626 (MYC)
   05224 Breast cancer
    694626 (MYC)
   05222 Small cell lung cancer
    694626 (MYC)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    694626 (MYC)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    694626 (MYC)
   05161 Hepatitis B
    694626 (MYC)
   05160 Hepatitis C
    694626 (MYC)
   05163 Human cytomegalovirus infection
    694626 (MYC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    694626 (MYC)
   05169 Epstein-Barr virus infection
    694626 (MYC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcc03000]
    694626 (MYC)
   03019 Messenger RNA biogenesis [BR:mcc03019]
    694626 (MYC)
Transcription factors [BR:mcc03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    694626 (MYC)
Messenger RNA biogenesis [BR:mcc03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     694626 (MYC)
SSDB
Motif
Pfam: Myc_N Myc-LZ HLH TRH
Other DBs
NCBI-GeneID: 694626
NCBI-ProteinID: NP_001136345
UniProt: B8XIA5 G7N040
LinkDB
Position
8
AA seq 439 aa
MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPP
LSPSRRSGLCSPSYVAVTPFSPRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPD
DETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQD
LSAAASECIDPSVVFPYPLNDSSSPKSCASPDSSAFSPSSDSLLSSTESSPQASPEPLVL
HEETPPTTSSDSEEEQEEEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRC
HVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENDKRRTHN
VLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEKDLL
RKRREQLKHKLEQLRNSCA
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgcccctcaacgttagcttcaccaacaggaactatgacctcgactacgactcggtgcag
ccgtatttctactgcgacgaggaggagaacttctaccagcagcaacagcagagcgagctg
cagccgccggcgcccagcgaggatatctggaagaaattcgagctgctgcccaccccgccc
ctgtcccctagccgccgctccgggctctgctcgccctcctacgttgcggtcacgcctttc
tcccctcggggagacaacgacggcggtggcgggagcttctccacggccgaccagctggag
atggtgaccgagctgctgggaggagacatggtgaaccagagcttcatctgcgacccggac
gacgagaccttcatcaaaaatatcatcatccaggactgtatgtggagcggcttctcggcc
gccgccaagctcgtctcagagaagctagcctcttaccaggctgcgcgcaaagacagcggc
agcccgaaccctgcccgcggccacagcgtctgctccacctccagcttgtacctgcaggat
ctgagcgccgccgcctcggagtgcatcgacccctcagtggtctttccctaccctctcaac
gacagcagctcgcccaagtcctgcgcctcaccggactccagcgccttctcaccgtcctcg
gattctctgctctcctcgacggagtcctccccgcaggccagcccagagcccctggtactc
catgaggagacaccgcccaccaccagcagcgactctgaggaggaacaagaagaggaggaa
gaaatcgatgttgtttctgtggaaaagaggcaggcccctggcaaaaggtcagagtcggga
tcaccttctgctggaggccacagcaaacctcctcacagcccactggtcctcaagaggtgc
cacgtctccacacatcagcacaactacgcggcgcctccctccactcggaaggactatcct
gctgccaagagggtcaagttggacagtgtcagagtcctgagacagatcagcaacaaccga
aaatgcaccagccccaggtcctcggacaccgaggagaatgacaagaggcgaacacacaac
gtcttggagcgccagaggaggaacgagctaaaacggagcttttttgccctgcgtgaccag
atcccggagttggaaaacaatgaaaaggcccccaaggtagttatccttaaaaaagccaca
gcatacatcctgtccgtccaagcagaggagcaaaagctcatttctgaaaaggatttgttg
cggaaacgacgagaacagttgaaacacaaacttgaacagctacggaactcttgtgcataa

DBGET integrated database retrieval system