KEGG   Macaca mulatta (rhesus monkey): 694747
Entry
694747            CDS       T01028                                 

Gene name
IL12B
Definition
(RefSeq) interleukin-12 subunit beta precursor
  KO
K05425  interleukin 12B
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04620  Toll-like receptor signaling pathway
mcc04622  RIG-I-like receptor signaling pathway
mcc04625  C-type lectin receptor signaling pathway
mcc04630  JAK-STAT signaling pathway
mcc04658  Th1 and Th2 cell differentiation
mcc04940  Type I diabetes mellitus
mcc05133  Pertussis
mcc05134  Legionellosis
mcc05140  Leishmaniasis
mcc05142  Chagas disease
mcc05143  African trypanosomiasis
mcc05145  Toxoplasmosis
mcc05146  Amoebiasis
mcc05152  Tuberculosis
mcc05162  Measles
mcc05164  Influenza A
mcc05168  Herpes simplex virus 1 infection
mcc05171  Coronavirus disease - COVID-19
mcc05200  Pathways in cancer
mcc05205  Proteoglycans in cancer
mcc05321  Inflammatory bowel disease
mcc05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    694747 (IL12B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    694747 (IL12B)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    694747 (IL12B)
   04622 RIG-I-like receptor signaling pathway
    694747 (IL12B)
   04625 C-type lectin receptor signaling pathway
    694747 (IL12B)
   04658 Th1 and Th2 cell differentiation
    694747 (IL12B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    694747 (IL12B)
   05205 Proteoglycans in cancer
    694747 (IL12B)
  09163 Immune disease
   05321 Inflammatory bowel disease
    694747 (IL12B)
   05330 Allograft rejection
    694747 (IL12B)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    694747 (IL12B)
  09171 Infectious disease: bacterial
   05133 Pertussis
    694747 (IL12B)
   05134 Legionellosis
    694747 (IL12B)
   05152 Tuberculosis
    694747 (IL12B)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    694747 (IL12B)
   05164 Influenza A
    694747 (IL12B)
   05162 Measles
    694747 (IL12B)
   05168 Herpes simplex virus 1 infection
    694747 (IL12B)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    694747 (IL12B)
   05145 Toxoplasmosis
    694747 (IL12B)
   05140 Leishmaniasis
    694747 (IL12B)
   05142 Chagas disease
    694747 (IL12B)
   05143 African trypanosomiasis
    694747 (IL12B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    694747 (IL12B)
   00536 Glycosaminoglycan binding proteins [BR:mcc00536]
    694747 (IL12B)
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Interleukins
   694747 (IL12B)
Glycosaminoglycan binding proteins [BR:mcc00536]
 Heparan sulfate / Heparin
  Cytokines
   694747 (IL12B)
SSDB
Motif
Pfam: IL12p40_C Ig_2 Ig_5 Ig_3 Ig_4 fn3 I-set
Other DBs
NCBI-GeneID: 694747
NCBI-ProteinID: NP_001038190
Ensembl: ENSMMUG00000021701
UniProt: P48095
LinkDB
Position
6
AA seq 328 aa
MCHQQLVISWFSLVFLASPLMAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITW
TLDQSGEVLGSGKTLTIQVKEFGDAGQYTCHKGGEALSHSLLLLHKKEDGIWSTDVLKDQ
KEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSNPQGVTCGAVTLSAERV
RGDNKEYEYSVECQEDSACPAAEERLPIEVMVDAIHKLKYENYTSSFFIRDIIKPDPPKN
LQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCIQVQGKSKREKKDRIFTDKTSATVIC
RKNASFSVQAQDRYYSSSWSEWASVPCS
NT seq 987 nt   +upstreamnt  +downstreamnt
atgtgtcaccagcagctggtcatctcttggttttccctggtttttctggcatctcccctc
atggccatatgggaactgaagaaagacgtttatgttgtagaattggactggtacccggat
gcccctggagaaatggtggtcctcacctgtgacacccctgaagaagatggtatcacctgg
accttggaccagagtggtgaggtcttaggctctggcaaaaccctgaccatccaagtcaaa
gagtttggagatgctggccagtacacctgtcacaaaggaggcgaggctctaagccattca
ctcctgctgcttcacaaaaaggaagatggaatttggtccactgatgttttaaaggaccag
aaagaacccaaaaataagacctttctaagatgtgaggccaaaaattattctggacgtttc
acctgctggtggctgacgacaatcagtactgatctgacattcagtgtcaaaagcagcaga
ggctcttctaacccccaaggggtgacgtgtggagccgttacactctctgcagagagggtc
agaggggacaataaggagtatgagtactcagtggagtgccaggaggacagtgcctgccca
gccgctgaggagaggctgcccattgaggtcatggtggatgccattcacaagctcaagtat
gaaaactacaccagcagcttcttcatcagggacatcatcaaacccgacccacccaagaac
ttgcagctgaagccattaaagaattctcggcaggtggaggtcagctgggagtaccctgac
acctggagtactccacattcctacttctccctgacattctgcatccaggtccagggcaag
agcaagagagaaaagaaagatagaatcttcacagacaagacctcagccacggtcatctgc
cgcaaaaatgccagctttagcgtgcaggcccaggaccgctactatagctcatcttggagc
gaatgggcatctgtgccctgcagttag

KEGG   Macaca mulatta (rhesus monkey): 703205
Entry
703205            CDS       T01028                                 

Gene name
IL12A
Definition
(RefSeq) interleukin-12 subunit alpha
  KO
K05406  interleukin 12A
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04620  Toll-like receptor signaling pathway
mcc04622  RIG-I-like receptor signaling pathway
mcc04625  C-type lectin receptor signaling pathway
mcc04630  JAK-STAT signaling pathway
mcc04658  Th1 and Th2 cell differentiation
mcc04940  Type I diabetes mellitus
mcc05133  Pertussis
mcc05134  Legionellosis
mcc05140  Leishmaniasis
mcc05142  Chagas disease
mcc05143  African trypanosomiasis
mcc05144  Malaria
mcc05145  Toxoplasmosis
mcc05146  Amoebiasis
mcc05152  Tuberculosis
mcc05162  Measles
mcc05164  Influenza A
mcc05168  Herpes simplex virus 1 infection
mcc05171  Coronavirus disease - COVID-19
mcc05200  Pathways in cancer
mcc05321  Inflammatory bowel disease
mcc05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    703205 (IL12A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    703205 (IL12A)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    703205 (IL12A)
   04622 RIG-I-like receptor signaling pathway
    703205 (IL12A)
   04625 C-type lectin receptor signaling pathway
    703205 (IL12A)
   04658 Th1 and Th2 cell differentiation
    703205 (IL12A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    703205 (IL12A)
  09163 Immune disease
   05321 Inflammatory bowel disease
    703205 (IL12A)
   05330 Allograft rejection
    703205 (IL12A)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    703205 (IL12A)
  09171 Infectious disease: bacterial
   05133 Pertussis
    703205 (IL12A)
   05134 Legionellosis
    703205 (IL12A)
   05152 Tuberculosis
    703205 (IL12A)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    703205 (IL12A)
   05164 Influenza A
    703205 (IL12A)
   05162 Measles
    703205 (IL12A)
   05168 Herpes simplex virus 1 infection
    703205 (IL12A)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    703205 (IL12A)
   05144 Malaria
    703205 (IL12A)
   05145 Toxoplasmosis
    703205 (IL12A)
   05140 Leishmaniasis
    703205 (IL12A)
   05142 Chagas disease
    703205 (IL12A)
   05143 African trypanosomiasis
    703205 (IL12A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    703205 (IL12A)
   00536 Glycosaminoglycan binding proteins [BR:mcc00536]
    703205 (IL12A)
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  Interleukins
   703205 (IL12A)
Glycosaminoglycan binding proteins [BR:mcc00536]
 Heparan sulfate / Heparin
  Cytokines
   703205 (IL12A)
SSDB
Motif
Pfam: IL12
Other DBs
NCBI-GeneID: 703205
NCBI-ProteinID: NP_001038199
Ensembl: ENSMMUG00000023084
UniProt: P48091
LinkDB
Position
2
AA seq 253 aa
MWPPGSASQPPPSPATATGLHPAARPEPPQCRLSMCPARSLLLVATLVLLDYLSLARNLS
VATPGPEMFPCLHHSQNLLKAASNTLQKARQILEFYPCTSEEIDHEDITKDKTSTVEACL
PLELIKNESCLNSRETSFITNGSCLASRKTSFMMALCLRSIYEDLKMYQVEFKTMNAKLL
RDPKRQIFLDQNILGVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRA
VTIDRVMSYLNAS
NT seq 762 nt   +upstreamnt  +downstreamnt
atgtggccccctgggtcagcctcgcagccaccgccctcacctgccacggccacaggtctg
catccagcggctcgcccagagcccccgcagtgccggctcagcatgtgtccagcgcgcagc
ctcctccttgtggccaccctagtcctcctggactacctcagtttggccagaaacctctcc
gtggccaccccaggcccagaaatgttcccgtgccttcaccactcccaaaacctgctgaag
gccgccagcaacacgcttcagaaggccagacaaattctagaattttacccttgcacttct
gaagagattgatcatgaagatatcacaaaagataaaaccagcacagtagaggcctgttta
ccattggaattaatcaagaatgagagttgcctaaattccagagagacttctttcataact
aatgggagttgcctggcctccagaaagacctcttttatgatggccctgtgccttaggagt
atttatgaagacttgaagatgtaccaagtggagttcaagaccatgaatgcaaagcttctg
agggatcctaagaggcagatctttctagatcaaaacatactgggagttattgatgagctg
atgcaggccctgaatttcaacagtgagactgtgccacaaaaatcctcccttgaagaaccg
gatttttataaaactaaaatcaagctctgcatacttcttcatgctttcagaattcgggca
gtgactattgatagagtgatgagctatctgaatgcttcctaa

DBGET integrated database retrieval system