KEGG   Macaca mulatta (rhesus monkey): 694844
Entry
694844            CDS       T01028                                 

Gene name
NFKBIB
Definition
(RefSeq) NF-kappa-B inhibitor beta
  KO
K02581  NF-kappa-B inhibitor beta
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04062  Chemokine signaling pathway
mcc04621  NOD-like receptor signaling pathway
mcc04622  RIG-I-like receptor signaling pathway
mcc04623  Cytosolic DNA-sensing pathway
mcc04658  Th1 and Th2 cell differentiation
mcc04659  Th17 cell differentiation
mcc04660  T cell receptor signaling pathway
mcc04662  B cell receptor signaling pathway
mcc04722  Neurotrophin signaling pathway
mcc04920  Adipocytokine signaling pathway
mcc05140  Leishmaniasis
mcc05145  Toxoplasmosis
mcc05162  Measles
mcc05164  Influenza A
mcc05169  Epstein-Barr virus infection
mcc05171  Coronavirus disease - COVID-19
mcc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    694844 (NFKBIB)
   04622 RIG-I-like receptor signaling pathway
    694844 (NFKBIB)
   04623 Cytosolic DNA-sensing pathway
    694844 (NFKBIB)
   04660 T cell receptor signaling pathway
    694844 (NFKBIB)
   04658 Th1 and Th2 cell differentiation
    694844 (NFKBIB)
   04659 Th17 cell differentiation
    694844 (NFKBIB)
   04662 B cell receptor signaling pathway
    694844 (NFKBIB)
   04062 Chemokine signaling pathway
    694844 (NFKBIB)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    694844 (NFKBIB)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    694844 (NFKBIB)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    694844 (NFKBIB)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    694844 (NFKBIB)
   05164 Influenza A
    694844 (NFKBIB)
   05162 Measles
    694844 (NFKBIB)
   05169 Epstein-Barr virus infection
    694844 (NFKBIB)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    694844 (NFKBIB)
   05140 Leishmaniasis
    694844 (NFKBIB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcc03000]
    694844 (NFKBIB)
Transcription factors [BR:mcc03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    694844 (NFKBIB)
SSDB
Motif
Pfam: Ank_2 Ank_3 Ank Ank_4 Ank_5
Other DBs
NCBI-GeneID: 694844
NCBI-ProteinID: NP_001245086
Ensembl: ENSMMUG00000023643
UniProt: H9YVM8 G7NNJ5
LinkDB
Position
19
AA seq 356 aa
MAGVACLGKAADADEWCDSGLGSLGPDAAAPGGPGLGAELGPGLSWAPLVFGYVTEDGDT
ALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGEASTVEKLYAAGAGL
CVAERRGHTALHLACRVGAHACARALLQPRPRRPREAPDTSLAQGPDHTPDTNHTPVALY
PDSDLEKEEEESEEDWKLQLEAENYEGHTPLHVAVIHKDVEMVRLLRDAGADLDKPEPTC
GRSPLHLAVEAQAADVLELLLRAGANPVARMYGGRTPLGSAMLRPSPILARLLRAHGAPE
PEGEDDKPGPCSSSSDSDSGDEGDEYDDIVVHSGRSHTRLPPTPASKPLPDDPGPV
NT seq 1071 nt   +upstreamnt  +downstreamnt
atggctggggtcgcgtgcttgggaaaagctgccgacgcagatgaatggtgcgacagcggc
ctcggctccctgggtccggacgcagcggcccccggaggaccgggattgggcgcggagctg
ggcccggggctgtcgtgggctcccctcgtcttcggctacgtcactgaggatggggacacg
gcactgcacttggccgtgattcatcagcatgaacccttcctggattttcttctaggcttc
tcagctggtactgagtacatggacctgcagaatgacctaggccagacggccctgcacctg
gcagccatcctgggggaggcatccacggtggagaagctgtatgcagcaggcgccgggctg
tgcgtggcggagcgtaggggccacacggcgctgcacctggcctgccgtgtgggagcacac
gcctgtgcccgtgccctgcttcagccccgcccccggcgccccagggaagcccccgacacc
tccctcgctcagggccctgaccatactcccgacaccaaccacacccctgtcgccttgtac
cccgattccgacttggagaaggaagaagaggagagtgaggaggactggaagctgcagctg
gaggctgaaaactacgagggccacaccccactccatgtggccgttatccacaaagatgtg
gagatggttcggctgctccgagatgctggagctgaccttgacaaaccggagcccacgtgc
ggccggagccctctgcacttggcagtggaggcccaggcggccgatgtgctggagcttctc
ctgagggcaggcgcaaaccctgttgcccgcatgtacggtggccgcaccccactgggcagt
gccatgctccggcccagccccatcctcgcccgcctcctccgtgcacacggagcccctgag
cctgagggcgaggacgacaaacccggcccctgcagcagcagtagcgacagcgacagcgga
gacgagggcgatgaatacgacgacattgtggttcacagcggccgcagccacacccggctg
cctcccaccccagcctcaaaacctcttcctgacgaccccggccccgtctga

KEGG   Macaca mulatta (rhesus monkey): 695335
Entry
695335            CDS       T01028                                 

Gene name
NFKBIA
Definition
(RefSeq) NF-kappa-B inhibitor alpha
  KO
K04734  NF-kappa-B inhibitor alpha
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04024  cAMP signaling pathway
mcc04062  Chemokine signaling pathway
mcc04064  NF-kappa B signaling pathway
mcc04210  Apoptosis
mcc04380  Osteoclast differentiation
mcc04620  Toll-like receptor signaling pathway
mcc04621  NOD-like receptor signaling pathway
mcc04622  RIG-I-like receptor signaling pathway
mcc04623  Cytosolic DNA-sensing pathway
mcc04625  C-type lectin receptor signaling pathway
mcc04657  IL-17 signaling pathway
mcc04658  Th1 and Th2 cell differentiation
mcc04659  Th17 cell differentiation
mcc04660  T cell receptor signaling pathway
mcc04662  B cell receptor signaling pathway
mcc04668  TNF signaling pathway
mcc04722  Neurotrophin signaling pathway
mcc04920  Adipocytokine signaling pathway
mcc04926  Relaxin signaling pathway
mcc04931  Insulin resistance
mcc05132  Salmonella infection
mcc05134  Legionellosis
mcc05135  Yersinia infection
mcc05140  Leishmaniasis
mcc05142  Chagas disease
mcc05145  Toxoplasmosis
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05162  Measles
mcc05163  Human cytomegalovirus infection
mcc05164  Influenza A
mcc05166  Human T-cell leukemia virus 1 infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05171  Coronavirus disease - COVID-19
mcc05200  Pathways in cancer
mcc05203  Viral carcinogenesis
mcc05215  Prostate cancer
mcc05220  Chronic myeloid leukemia
mcc05222  Small cell lung cancer
mcc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    695335 (NFKBIA)
   04668 TNF signaling pathway
    695335 (NFKBIA)
   04024 cAMP signaling pathway
    695335 (NFKBIA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    695335 (NFKBIA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    695335 (NFKBIA)
   04621 NOD-like receptor signaling pathway
    695335 (NFKBIA)
   04622 RIG-I-like receptor signaling pathway
    695335 (NFKBIA)
   04623 Cytosolic DNA-sensing pathway
    695335 (NFKBIA)
   04625 C-type lectin receptor signaling pathway
    695335 (NFKBIA)
   04660 T cell receptor signaling pathway
    695335 (NFKBIA)
   04658 Th1 and Th2 cell differentiation
    695335 (NFKBIA)
   04659 Th17 cell differentiation
    695335 (NFKBIA)
   04657 IL-17 signaling pathway
    695335 (NFKBIA)
   04662 B cell receptor signaling pathway
    695335 (NFKBIA)
   04062 Chemokine signaling pathway
    695335 (NFKBIA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    695335 (NFKBIA)
   04926 Relaxin signaling pathway
    695335 (NFKBIA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    695335 (NFKBIA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    695335 (NFKBIA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    695335 (NFKBIA)
   05203 Viral carcinogenesis
    695335 (NFKBIA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    695335 (NFKBIA)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    695335 (NFKBIA)
   05215 Prostate cancer
    695335 (NFKBIA)
   05222 Small cell lung cancer
    695335 (NFKBIA)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    695335 (NFKBIA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    695335 (NFKBIA)
   05135 Yersinia infection
    695335 (NFKBIA)
   05134 Legionellosis
    695335 (NFKBIA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    695335 (NFKBIA)
   05170 Human immunodeficiency virus 1 infection
    695335 (NFKBIA)
   05161 Hepatitis B
    695335 (NFKBIA)
   05160 Hepatitis C
    695335 (NFKBIA)
   05171 Coronavirus disease - COVID-19
    695335 (NFKBIA)
   05164 Influenza A
    695335 (NFKBIA)
   05162 Measles
    695335 (NFKBIA)
   05168 Herpes simplex virus 1 infection
    695335 (NFKBIA)
   05163 Human cytomegalovirus infection
    695335 (NFKBIA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    695335 (NFKBIA)
   05169 Epstein-Barr virus infection
    695335 (NFKBIA)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    695335 (NFKBIA)
   05140 Leishmaniasis
    695335 (NFKBIA)
   05142 Chagas disease
    695335 (NFKBIA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcc03000]
    695335 (NFKBIA)
   04131 Membrane trafficking [BR:mcc04131]
    695335 (NFKBIA)
Transcription factors [BR:mcc03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    695335 (NFKBIA)
Membrane trafficking [BR:mcc04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    695335 (NFKBIA)
SSDB
Motif
Pfam: Ank_2 Ank Ank_3 Ank_5 Ank_4
Other DBs
NCBI-GeneID: 695335
NCBI-ProteinID: NP_001244679
Ensembl: ENSMMUG00000020374
UniProt: H9FUW3
LinkDB
Position
7
AA seq 317 aa
MFQAAERPQEWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELQEIRLEPQEVP
RGAEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVI
TNQPEIAEALLGAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQSCTTPHLHSILKATN
YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG
ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEFTE
DELPYDDCVFGGQRLTL
NT seq 954 nt   +upstreamnt  +downstreamnt
atgttccaggcggccgagcgcccccaggagtgggccatggagggtccccgcgacgggctg
aagaaggaacgactgctggacgaccgccacgacagcggcctggactccatgaaggatgag
gagtacgagcagatggtcaaggagctgcaggagatccgcctcgagccgcaggaggtgccg
cgcggcgcggagccctggaagcagcagctcaccgaggacggggactcgtttctgcacttg
gccatcatccatgaagaaaaggcactgaccatggaagtgatccgccaggtgaagggagac
ctggccttcctcaacttccagaacaacctgcagcagactccactccacttggctgtgatc
accaaccagccagaaattgctgaggcacttctgggagctggctgtgatcctgagctccga
gactttcgaggaaatacccccctacaccttgcctgtgagcagggctgcttggccagcgtg
ggagtcctgactcagtcctgcaccaccccgcacctccactccatcctgaaggctaccaac
tacaatggccacacgtgtctgcacttagcctctatccatggctacctgggcattgtggag
cttttggtgtccttgggtgctgatgtcaatgctcaggagccctgtaacggccggactgcc
cttcacctcgcagtggacctgcagaatcctgacctggtgtcgctcctgttgaagtgtggg
gctgatgtcaacagagttacctaccagggctattctccctaccagctcacctggggccgc
ccaagcacccggatacagcagcagctgggccagctgacactggaaaaccttcagatgctg
ccggagagtgaggatgaggagagctatgacacagagtcagagttcacggagttcacggag
gatgagctgccctatgacgactgtgtgtttggaggccagcgtctgacattatga

DBGET integrated database retrieval system