KEGG   Macaca mulatta (rhesus monkey): 694963
Entry
694963            CDS       T01028                                 

Gene name
PLD1
Definition
(RefSeq) phospholipase D1 isoform X1
  KO
K01115  phospholipase D1/2 [EC:3.1.4.4]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00564  Glycerophospholipid metabolism
mcc00565  Ether lipid metabolism
mcc01100  Metabolic pathways
mcc04014  Ras signaling pathway
mcc04024  cAMP signaling pathway
mcc04071  Sphingolipid signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04144  Endocytosis
mcc04666  Fc gamma R-mediated phagocytosis
mcc04724  Glutamatergic synapse
mcc04912  GnRH signaling pathway
mcc04928  Parathyroid hormone synthesis, secretion and action
mcc05200  Pathways in cancer
mcc05212  Pancreatic cancer
mcc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    694963 (PLD1)
   00565 Ether lipid metabolism
    694963 (PLD1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    694963 (PLD1)
   04072 Phospholipase D signaling pathway
    694963 (PLD1)
   04071 Sphingolipid signaling pathway
    694963 (PLD1)
   04024 cAMP signaling pathway
    694963 (PLD1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    694963 (PLD1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    694963 (PLD1)
  09152 Endocrine system
   04912 GnRH signaling pathway
    694963 (PLD1)
   04928 Parathyroid hormone synthesis, secretion and action
    694963 (PLD1)
  09156 Nervous system
   04724 Glutamatergic synapse
    694963 (PLD1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    694963 (PLD1)
   05231 Choline metabolism in cancer
    694963 (PLD1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    694963 (PLD1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    694963 (PLD1)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.4  phospholipase D
     694963 (PLD1)
Membrane trafficking [BR:mcc04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    694963 (PLD1)
 Endosome - Golgi transport
  Others
   Others
    694963 (PLD1)
SSDB
Motif
Pfam: PLDc_2 PX PLDc PH DUF3785
Other DBs
NCBI-GeneID: 694963
NCBI-ProteinID: XP_001085464
Ensembl: ENSMMUG00000023289
LinkDB
Position
2
AA seq 1074 aa
MSLKTESRVNTSALQKIAADMSNIIENLDTRELHFEGEEVEYDVSPSDPKIQEVYIPFSA
VYNTQGFKEPNIQTYLSGCPIKAQVLEVERFTSTTRVPSINLYTIELTHGEFKWQVKRKF
KHFQEFHRELLKYKAFIRIPIPTRRHTFRRQNVREEPREMPSLPRSSENMIREEQFLGRR
KQLEDYLTKILKMPMYRNYHATTEFLDISQLSFIHDLGPKGIEGMIMKRSGGHRIPGLNC
CGQGRACYRWSKRWLIVKDSFLLYMKPDSGAIAFVLLVDKEFKIKVGKKETETKYGIRID
NLSRTLILKCNSYRHARWWGGAIEEFIQKYGTNFLKDHRFGSYAAIQENALAKWYVNAKG
YFEDVANAMEEANEEIFITDWWLSPEIFLKRPVVEGNRWRLDCILKRKAQQGVRIFIMLY
KEVELALGINSEYTKRTLMRLHPNIKVMRHPDHVSSTVYLWAHHEKLVIIDQSVAFVGGI
DLAYGRWDDNEHRLTDVGSVKRVTSGPSLGSLPPAATESMESLSLKDKNEPDQNLPIRNS
VDDVDSKLKGIGKPRKFSKFSLYRQLHRHHLHNADSISSIDSTSSCFNHYRSHHNLIHGL
KPHFKLFRPSSESEQGLTRPNADTGSIRSLQTGVGELHGETRFWHGKDYCNFVFKDWVQL
DKPFADFIDRYSMPRMPWHDIASAVHGKAARDVARHFIQRWNFTKIMKSKYRSLSYPFLL
PKSQTTAHELRYQVPGSVHANVQLLRSAADWSAGIKYHEESIHAAYVHVIENSRHYIYIE
NQFFISCADDKVVFNKIGDAIAQRILKAHRENQKYRVYVVIPLLPGFEGDISTGGGNALQ
AIMHFNYRTMCRGENSILGQLKAELGNQWINYISFCGLRTHAELEGNLVTELIYVHSKLL
IADDNTVIIGSANINDRSMLGKRDSEMAVIVQDTETVPSVMGGEKYQAGRFAQGLRLQCF
RVVLGYLDDPSEDIQDPVSDKFFKEVWVSTAARNATIYDKVFRCLPNDEVHNLIQLRDFI
NKPILAKEDPIRAEEELKKIRGFLVQFPFYFLSEESLLPSVGTKEAIVPMEVWT
NT seq 3225 nt   +upstreamnt  +downstreamnt
atgtcactgaaaaccgagtcacgggtaaatacctctgcactgcagaaaattgctgctgac
atgagtaatatcatagaaaatctggacacgcgggaactccactttgagggagaggaggta
gaatacgacgtgtctcccagcgatcccaagatacaggaagtgtatatccctttctctgct
gtttataacactcaaggatttaaggagcctaatatacagacgtatctctctggctgtcca
ataaaagcacaagttttggaagtggaacgcttcacatctacaacaagggtaccaagtatt
aatctttacactattgaattaacacatggggaatttaaatggcaagttaagaggaaattc
aagcactttcaagaatttcacagagagctgctcaagtacaaagcatttatccgaatcccc
attcccaccagaagacacacatttaggaggcaaaacgtgagagaggagcctcgagagatg
cccagtttgccccgttcatctgaaaacatgataagagaagaacaattccttggtagaaga
aaacaactggaagattacttgacaaagatactaaaaatgcccatgtatcgaaactatcat
gccacaacagagtttcttgatataagccagctatctttcatccatgatttgggaccaaag
ggcatagaaggtatgataatgaaaagatctggaggacacagaataccaggcttgaattgc
tgtggtcagggaagagcctgctacagatggtcaaaaagatggttaatagtgaaagattcc
tttttactgtatatgaaaccagacagcggtgccattgccttcgtcctgctggtagacaaa
gaattcaaaattaaggtggggaagaaggagacagaaacgaaatatggaatccgaattgat
aatctttcaaggacacttattttaaaatgcaacagctatagacatgctcgctggtgggga
ggggctatagaagaattcatccagaaatatggcaccaactttctcaaagatcatcgattt
gggtcatatgctgctatccaagagaatgctttagctaaatggtatgttaatgccaaagga
tattttgaagatgtggcaaatgcaatggaagaggcaaatgaagagatttttatcacagat
tggtggctgagtccagaaatcttcctgaaacgcccggtggttgagggaaatcgttggagg
ttggactgcattcttaaacgaaaagcacaacaaggggtgaggatcttcataatgctctac
aaagaggtggaacttgctcttggcatcaatagtgaatacaccaagaggacattgatgcgt
ctacaccccaacataaaggtgatgagacatccggatcatgtgtcgtccaccgtctatttg
tgggctcaccatgagaagcttgtcatcattgaccaatcggtggcctttgtaggagggatt
gacctggcctatggaaggtgggatgacaatgagcacagactcacagatgtgggcagcgtg
aagcgagtcacttcaggaccatctctgggttccctcccacctgccgcaacagagtctatg
gaatccttaagcctcaaagataaaaatgagcctgatcaaaacctgcccatccggaatagt
gttgatgatgtggattcaaaactgaaaggaataggaaagccaagaaagttctccaaattt
agtctctacaggcagctccacaggcaccacctgcacaacgcagatagcatcagcagcatt
gacagcacctccagttgttttaatcactatagaagtcatcacaatttaatccatggttta
aaaccccacttcaaactctttcgcccatcaagtgagtctgagcaaggactcactagacct
aatgctgataccgggtccatccgcagtttacagacaggtgtgggagagttgcatggggaa
accagattctggcatggaaaggactactgcaatttcgtcttcaaagactgggttcaactt
gataaaccttttgctgatttcattgacaggtactccatgccccggatgccctggcatgac
attgcctctgcagtccacgggaaggcagctcgtgatgtggcacgtcacttcatccagcgc
tggaacttcacgaaaattatgaaatcaaaatatcggtccctttcttatccttttctgctt
ccaaagtctcaaacaacagcccatgagttgagatatcaagtacctgggtctgtccatgct
aacgtacagttgctccgctctgctgctgattggtctgctggtataaagtaccatgaagag
tccatccatgccgcttacgtccatgtgatagagaacagcaggcactatatctatattgaa
aaccagtttttcataagctgtgctgatgacaaagttgtgttcaacaagataggcgatgcc
attgcccagaggatcctgaaagctcacagggaaaaccagaaataccgggtatatgtcgtg
ataccgcttctgccagggttcgaaggagacatttcaaccggcggaggaaatgctctacag
gcaatcatgcacttcaactacagaaccatgtgcagaggagaaaattccatccttggacag
ttaaaagcagagcttggcaatcagtggataaattacatatcattctgtggtcttagaaca
catgcagagctcgaaggaaacctagtcaccgagcttatctatgtccacagcaagttgtta
attgctgatgataacactgttattattggctctgccaacataaatgaccggagtatgctg
ggaaagcgtgacagtgaaatggctgtcattgtgcaagatacagaaacggttccttcagta
atgggtggagaaaagtaccaagctggccggtttgcccaaggacttcggctacagtgcttt
agggtcgtccttggctatcttgatgacccaagtgaggacattcaggatccagtgagtgac
aaattcttcaaggaggtgtgggtttcaacagcagctcgaaatgctacaatttatgacaag
gtgttccggtgccttcccaatgatgaagtacacaatttaattcagctgagagactttata
aacaagcccatattagctaaggaagatcccattcgagctgaggaggaactgaagaagatc
cgtggatttttggtgcaattccccttttatttcttgtctgaagaaagcctactgccttct
gttggaaccaaagaggccatagtgcccatggaggtttggacttaa

KEGG   Macaca mulatta (rhesus monkey): 721573
Entry
721573            CDS       T01028                                 

Gene name
PLD2
Definition
(RefSeq) phospholipase D2 isoform X2
  KO
K01115  phospholipase D1/2 [EC:3.1.4.4]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00564  Glycerophospholipid metabolism
mcc00565  Ether lipid metabolism
mcc01100  Metabolic pathways
mcc04014  Ras signaling pathway
mcc04024  cAMP signaling pathway
mcc04071  Sphingolipid signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04144  Endocytosis
mcc04666  Fc gamma R-mediated phagocytosis
mcc04724  Glutamatergic synapse
mcc04912  GnRH signaling pathway
mcc04928  Parathyroid hormone synthesis, secretion and action
mcc05200  Pathways in cancer
mcc05212  Pancreatic cancer
mcc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    721573 (PLD2)
   00565 Ether lipid metabolism
    721573 (PLD2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    721573 (PLD2)
   04072 Phospholipase D signaling pathway
    721573 (PLD2)
   04071 Sphingolipid signaling pathway
    721573 (PLD2)
   04024 cAMP signaling pathway
    721573 (PLD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    721573 (PLD2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    721573 (PLD2)
  09152 Endocrine system
   04912 GnRH signaling pathway
    721573 (PLD2)
   04928 Parathyroid hormone synthesis, secretion and action
    721573 (PLD2)
  09156 Nervous system
   04724 Glutamatergic synapse
    721573 (PLD2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    721573 (PLD2)
   05231 Choline metabolism in cancer
    721573 (PLD2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    721573 (PLD2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    721573 (PLD2)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.4  phospholipase D
     721573 (PLD2)
Membrane trafficking [BR:mcc04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    721573 (PLD2)
 Endosome - Golgi transport
  Others
   Others
    721573 (PLD2)
SSDB
Motif
Pfam: PX PLDc_2 PLDc PH PH_2
Other DBs
NCBI-GeneID: 721573
NCBI-ProteinID: XP_014973820
Ensembl: ENSMMUG00000005666
UniProt: A0A5F7ZER1 A0A5K1UE21
LinkDB
Position
16
AA seq 933 aa
MMATPESLFPTGDELDSSQLQMESDEVDTLREGEDPADRMHPFLATYELQPLKVHPLVFA
PGVPVTAQVVGTERYTSGSKVGTCTLYSVRLTHGDFTWTTKKKFRHFQELHRDLLRHKVL
MSLLPLARFAVAYSPAQDAANREMPSLPRAGPEGSTRHAASKQKYLENYLNRLLTMSFYR
NYHALTEFLEVSQLSFIPDLGCKGLEGTIRKRSGGHRVPGLTCCGRDQVCYRWSKRWLVV
KDSFLLYMCLETGAISFVQLFDPGFEVQVGKRSTEARYGVRIDTSHRSLILKCSSYRQAR
WWAQEITELARGPGRDFLQLHQHDSYAPSRPGTLARWFVNGAGYFAAVADAILRAQEEIF
ITDWWLSPEVYLKRPAHSDDWRLDIMLKRKAEEGVRVSILLFKEVELALGINSGYSKRAL
MLLHPNIKVMRHPDQVTLWAHHEKLLVVDQVVAFLGGLDLAYGRWDDLHYRLTDLGDSSE
SAASQPPTPCPDSPATPDLSHNQFFWLGKDYSNLITKDWVQLDRPFEDFIDRETTPRMPW
RDVGVVVHGLPARDLARHFIQRWNFTKTTKAKYKTPTYPYLLPKSTSTANQLPFTLPGGQ
CTTVQVLRSVDRWSAGTLENSILNAYLHTIKESRHFLYIENQFFISCSDGRTVLNKVGDE
IVDRILKAHKQGQCFRVYVLLPLLPGFEGDISTGGGNSIQAILHFTYRTLCRGEYSILHR
LKAAMGTAWRDYISICGLRTHGELGGHPVSELIYIHSKMLIADDRTVIIGSANINDRSLL
GKRDSELAVLIEDTETEPSLMNGVEYQAGRFALSLRKHCFSVILGANTRPDLDLRDPVCD
DFFQLWQDTAESNANIYEQIFRCLPTNATRSLRTLREYVAVEPLATVSPPLARSELTQVQ
GHLVHFPLKFLEDESLLPPLGSKEGMIPLEVWT
NT seq 2802 nt   +upstreamnt  +downstreamnt
atgatggcgacccctgagagcctcttccccactggggacgaactggactccagccagctc
cagatggagtccgatgaggtggacactctgagggagggagaggacccagccgaccggatg
cacccgtttctggccacctatgagcttcagcctctgaaagtgcaccccttggtgttcgca
cctggggtccctgtcacagcccaggtggtgggcaccgaaagatacaccagcggatccaag
gtaggaacctgcactctgtattctgtccgcttgactcacggcgactttacctggacaacc
aagaagaagttccgtcattttcaggagctgcatcgggacctcctgagacacaaagtcttg
atgagtctgctccctctggctcgttttgccgttgcctattctccagcccaagatgcagcc
aacagagagatgccctctctaccccgggcaggtcctgagggctctaccagacatgcagcc
agcaaacagaaatacctggagaattacctcaaccgcctcttgaccatgtctttctatcgc
aactaccatgccttgacagaattcctggaagtcagtcagctgtcctttatcccagacctg
ggctgcaaagggctggaggggacgatccggaagcgctcaggtggccaccgcgttcctggc
ctcacctgctgtggccgagaccaagtttgttatcgctggtccaagaggtggctggtggtg
aaggactccttcctgctgtacatgtgcctcgagacgggtgccatctcatttgttcagctc
tttgaccccggctttgaggtgcaggtggggaaaaggagcacggaggcacggtacggagtg
cggatcgacacctcccacaggtccttgattctcaagtgcagcagctaccggcaggcacgg
tggtgggcccaagagatcactgagctggcacggggcccaggcagagacttcctacagctg
caccagcatgacagctatgccccatcccggcctgggaccttggcccggtggtttgtgaat
ggggcaggttactttgctgctgtggcagatgccatccttcgagctcaagaggagattttc
atcacagactggtggttgagtcctgaggtttacctgaagcgtccagcccattcagatgac
tggagactggacattatgctcaagaggaaggcggaggagggtgtccgcgtgtccattctg
ctgtttaaggaagtggaattggccttgggcatcaacagtggctatagcaagagggcactg
atgctgctgcacccaaacataaaggtgatgcgtcacccagaccaagtgacgctgtgggcc
catcatgagaagctcctggtggtggaccaagtggtagcattcctggggggactggacctt
gcctatggccgctgggatgacctgcactaccgactgactgaccttggagactcctctgaa
tcagctgcctcccagcctcccaccccgtgcccagactcgccggccaccccagacctctct
cacaaccaattcttctggctgggcaaggactacagcaatcttatcaccaaggactgggtg
cagctcgaccggcctttcgaagatttcattgacagggagacgaccccacggatgccatgg
cgggacgttggggtggtcgtccacggcctacctgcccgggacctcgcccggcacttcatc
cagcgctggaacttcaccaagaccaccaaggccaagtacaagactcccacgtacccctac
ctgcttcccaagtctaccagcactgccaaccagctccccttcacgctcccaggggggcag
tgcaccactgtgcaggtcttgcggtcagtggaccgctggtcagcagggaccctggagaac
tccatcctcaatgcctacctccacaccatcaaggagagccggcacttcctctacattgag
aatcagttcttcattagctgctcagatgggcggacggttctgaacaaggtgggcgatgag
attgtggacagaatcctgaaggcccacaaacaggggcagtgtttccgagtctacgtgctt
ttgcccttactccctggcttcgagggtgatatctccacgggtggtggcaactccattcag
gccattctgcattttacttacaggaccctgtgtcgtggggagtattcaatcctgcatcgc
ctcaaagcagccatggggacagcatggcgggactatatttccatctgcgggcttcgtaca
cacggagaactgggcgggcaccccgtctcggagctcatctacatccacagcaagatgctc
atcgcagatgaccggacagtcatcatcggttctgcaaacatcaatgaccggagcttgctg
gggaagcgggacagtgagctggccgtgctcatcgaggacacagagacggaaccatccctc
atgaatggggtggagtatcaggcgggcaggtttgccttgagtctgcggaagcactgcttc
agtgtgattcttggagcaaatacccggccagacttggatctccgagaccccgtctgtgat
gacttcttccagttgtggcaagacacagctgagagcaacgccaacatctatgagcagatc
ttccgctgcctaccgaccaatgccacgcgttccctgcggacactccgggagtatgtggcc
gtggagcccttggccaccgtcagtcctcccttggctcggtctgagctcacccaggtccag
ggccacctggtccacttccccctcaagttccttgaggatgagtctttgttgcccccgctg
ggtagcaaggagggcatgatccccctagaagtgtggacatag

DBGET integrated database retrieval system