KEGG   Macaca mulatta (rhesus monkey): 694965
Entry
694965            CDS       T01028                                 

Gene name
TSC2
Definition
(RefSeq) tuberin isoform X7
  KO
K07207  tuberous sclerosis 2
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04072  Phospholipase D signaling pathway
mcc04115  p53 signaling pathway
mcc04140  Autophagy - animal
mcc04150  mTOR signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04152  AMPK signaling pathway
mcc04211  Longevity regulating pathway
mcc04218  Cellular senescence
mcc04714  Thermogenesis
mcc04910  Insulin signaling pathway
mcc04919  Thyroid hormone signaling pathway
mcc05163  Human cytomegalovirus infection
mcc05165  Human papillomavirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    694965 (TSC2)
   04151 PI3K-Akt signaling pathway
    694965 (TSC2)
   04152 AMPK signaling pathway
    694965 (TSC2)
   04150 mTOR signaling pathway
    694965 (TSC2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    694965 (TSC2)
  09143 Cell growth and death
   04115 p53 signaling pathway
    694965 (TSC2)
   04218 Cellular senescence
    694965 (TSC2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    694965 (TSC2)
   04919 Thyroid hormone signaling pathway
    694965 (TSC2)
  09149 Aging
   04211 Longevity regulating pathway
    694965 (TSC2)
  09159 Environmental adaptation
   04714 Thermogenesis
    694965 (TSC2)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    694965 (TSC2)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    694965 (TSC2)
   05163 Human cytomegalovirus infection
    694965 (TSC2)
   05165 Human papillomavirus infection
    694965 (TSC2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcc01009]
    694965 (TSC2)
Protein phosphatases and associated proteins [BR:mcc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     694965 (TSC2)
SSDB
Motif
Pfam: Tuberin DUF3384 Rap_GAP Telomere_reg-2 Cnd1
Other DBs
NCBI-GeneID: 694965
NCBI-ProteinID: XP_001083256
Ensembl: ENSMMUG00000002808
LinkDB
Position
20
AA seq 1944 aa
MLRSGRGATCCSFSPPGRRGLLPTPPRSSPGSQAPVPRQHPGAQGVHAGLLRTTHPGGPR
GPRHVTQGSPAFPLEGCLELQLPAGSVAALRAAPLPEVRVPLPAASGARGVRLSPRRGGP
ARGGAAREGCSGASWPTMAKPASKDSGLKEKFRILFGLGTPRPNPRSAEGKQTEFIITAE
ILRELSVECGLSNRIRMIGQICEVAKTKKFEEHAVEALWKAVADLLQPERPLEARHAVLA
LLKAIIQGQGERLGVLRALFFKVIKDYPSNEDLHERLDVFKALTDNGRHITYLEEELADF
VLQWMDVGLSSEFLLVLVNLVKFNSCYLDEYIARMVQMICLLCVRTASSVDIEVSLQVLD
AVVCYNCLPAESLPLFIVTLCRTINVKELCEPCWKLMRNLLGTHLGHSAIYNMCHLMEDR
AYMEDAPLLRGAVFFVGMALWGAHRLYSLRNSPTSVLPSFYQAMACPNEVVSYEIVLSIT
RLIKKYRKELQVVTWDILLNIIERLLQQLQTLDSPELRTIVHDLLTTVEELCDQNEFHGS
QERYFELVERCADQRPESSLLNLISYRAQSIHPAKDGWIQNLQALMERFFRSESRGAVRI
KVLDVLSFVLLINRQFYEEELINSVVISQLSHIPEDKDHQVRKLATQLLVDLAEGCHTHH
FNSLLDIIEKVMARSLSPPPELEERDVAAYSASLEDVKTAVLGLLVILQTKLYTLPASHA
TRVYEMLVSHIQLHYKHSYTLPIASSIRLQAFDFLLLLRADSLHRLGLPNKDGVVRFSPY
CVCDYMEPERGSEKKASGPLSPPTGPPGPAPAGPAVRLGSLPYSLLFRVLLQCLKQESDW
KVLKLVLGRLPESLRYKVLIFTSPCSVDQLCSALCSMLSGPKTLERLRGAPEGFSRTDLH
LAVVPVLTALISYHNYLDKTKQREMVYCLEQGLIHRCASQCVVALSICSVEMPDIMIKAL
PVLVVKLTHISATASMAVPLLEFLSTLARLPQLYRNFAAEQYASVFAISLPYTNPSKFNQ
YIVCLAHHVIAMWFIRCRLPFRKDFVPFITKGLRSNVLLSFDDTPEKDSFRARSTSLNER
PKSLRIARPPKQGLNNSPPVKEFKESSAAEAFRCRSISVSEHVVRSRIQTSLTSASLGSA
DENSVAQADDSLKSLHLELTETCLDMMARYVFSNFTAVPKRSPVGEFLLAGGRTKTWLVG
NKLVTVTTSVGTGTRSLLGLDSGELQSGPESSSSPGMNVRQTKEAPAKLESQAGQQVSRG
ARDRVRSMSGGHGLRVGALDVPASQFPGSAASPGPQTAPAAKPEKASAGARLPVQEKTNL
AAYVPLLTQGWAEILVRRPTGNTSWLMSLENPLSPFSSDINNMPLQELSNALMAAERFKE
HRDTALYKSLSVPAASTAKPPPLPRSNTVASFSSLYQSSCQGQLHRSVSWADSAVVMEEG
SPGEVPVPVEPPGLEDFEAALGVDRRTDAYSRSSSTSSQEEKSFHAEELVAGGIPIERAV
SSEGGRPSVDLSFQPSQPLSKSSSSPELQTLQDILGDPGDKADVGRLSPEVKARSQSGIL
DGESAAWPASGEDSRGQPEGPLPSSSPRSPSGLRPRGYTISDSAPSRRGRRVERDAFKSR
ATASNAEKVPGINPSFVFLQLYHSPFFGDESNKPILLPNESQSFERSVQLLDQIPSYDTH
KIAVLYVGEGQSNSELAILSNEHGSYRYTEFLTGLGRLIELKDCQPDKVYLGGLDVCGED
GQFTYCWHDDIMQAVFHIATLMPTKDVDKHRCDKKRHLGNDFVSIVYNDSGEDFKLGTIK
GQFNFVHVIITPLDYECNLVSLQCRKDMEGLVDTSVAKIVSDRNLPFVARQMALHANMAS
QVHHSRSNPTDIYPSKWIARLRHIKRLRQRICEEAAYSNPSLPLVHPPSHTKGPAQTPAE
PTPGYEMGQRKRLISSVEDFTEFV
NT seq 5835 nt   +upstreamnt  +downstreamnt
atgctccggtcagggcgcggcgctacctgctgcagcttctcccctccggggaggcgcggg
ctcctccccacacccccgcggtccagccctgggtcccaggctccggttccgcgtcagcat
cctggcgctcaaggagttcatgccggactcctgcggactacacatcccggcggcccacgc
ggcccccgtcacgtgacgcaaggatcgccggcctttccgctagagggctgcctagaacta
caactcccagcaggctccgtggcggccctccgcgcggcaccgctgccggaagtgcgggtc
ccgcttccggcagcgtccggggccaggggggttcgcctttctccgcgtcggggcggcccg
gcgcgcggtggcgcggcgagggaggggtgttctggtgcgtcctggcccaccatggccaaa
ccagcaagcaaagattcaggcttgaaggagaagtttaggattctgtttggactgggaaca
ccgaggccaaatcccaggtctgcagagggcaaacagacggaatttatcatcaccgccgaa
atcctgagagagctgagtgtggaatgcggcctcagcaatcgcatccggatgatagggcag
atttgtgaagtcgcaaaaaccaagaaatttgaagagcacgcagtggaagcactctggaag
gcggttgcggatctgttgcagccagaacggccgctggaggcccggcacgcggtgctggct
ctgctgaaggccatcattcaggggcagggcgagcgtttgggggtcctcagggccctcttc
tttaaggtcatcaaggattacccttccaacgaagacctccacgagaggctggacgttttc
aaggccctcacagacaatgggagacacatcacctacttggaggaagagctggcggacttt
gtcctgcagtggatggatgtcggcttgtcctcggaattccttctggtgctggtgaacttg
gtcaaattcaacagctgttacctcgatgagtacatcgcaaggatggttcagatgatctgc
ctgctctgcgtccggaccgcatcctctgtggacatagaggtctccctgcaggtgctggac
gccgtggtctgctacaactgcctgccggctgagagcctcccgctgttcatcgtcaccctg
tgccgcaccatcaatgtcaaggagctctgcgagccttgctggaagctgatgcggaacctc
cttggcacccacctgggccacagtgccatctacaacatgtgccacctcatggaggacaga
gcctatatggaggacgcgcccctgctgagaggagccgtgttttttgtgggcatggctctc
tggggagcccaccggctctattctctcaggaactcgccgacatcggtgctgccatcattt
taccaggccatggcatgtccgaacgaggtggtgtcctatgagatcgtcctgtccatcacc
aggctcatcaagaagtataggaaggagctccaggtggtgacgtgggacattctgctgaac
atcatcgaacggctccttcagcagctccagaccttggacagcccggagctcaggaccatc
gtccatgacctgctgaccacggtggaggagctgtgtgaccagaatgagttccacgggtct
caggagagatactttgaactggtggagagatgtgcagaccagaggcctgagtcctccctc
ctgaacctgatctcctacagagcgcagtccattcacccggccaaggacggctggattcag
aacctgcaggcgctgatggagagattcttcaggagcgagtcccgaggcgccgtgcgcatc
aaggtgctggatgtgctgtcctttgtgctgctcatcaacaggcagttctacgaggaggag
ctgattaactcagtggtcatctctcagctctcccacatccccgaggataaagaccatcag
gtccgaaagctggccacccagttgctggtggacctggcagagggctgccacacacaccac
ttcaacagtctgctggacatcatcgagaaggtgatggcccgctccctctccccacccccg
gagttggaagaaagggatgtggccgcgtactcggcgtccttggaggatgtgaagacagct
gtcctggggcttctggtcatccttcagactaagctgtacaccctgcctgcgagccatgcc
acgcgcgtttatgagatgctggtcagccacattcagctccactacaagcacagctacacc
ctgccaatcgccagcagcatccggctgcaggcctttgacttcctgttgctgctgcgggcc
gactcactgcaccgcctcggcctgcccaacaaggatggggtcgtgcggttcagcccctac
tgcgtctgcgactacatggagccggagagaggctctgagaagaaggccagcggccccctt
tctcctcccacagggccacctggcccggcgcctgcaggcccggctgtgcggctgggctcc
ctgccctactccctgctcttccgcgtcctgctgcagtgcttgaagcaggagtctgactgg
aaggtgctgaagctggttctgggcaggctgcctgagtccctgcgctacaaagtactcatc
tttacctccccttgcagtgtggaccagctgtgctctgctctctgctccatgctttcaggc
ccaaagacactggagcggctccgaggcgccccggaaggcttctccagaactgacctgcac
ctggctgtggttccagtgctgacggcattaatctcttaccataactacctggacaaaacc
aaacagcgcgagatggtctactgcctggagcagggcctcatccaccgctgtgccagccag
tgcgtcgtagccttgtccatctgcagcgtggagatgcctgacatcatgatcaaggcgctg
cccgtcctggtggtgaagctcacacacatctcggccacagccagcatggccgtcccgctg
ctggagttcctgtccactctggccaggctgccgcagctctacaggaacttcgccgcggag
cagtatgccagtgtgttcgccatctcactgccgtacaccaacccctccaagtttaatcag
tacatcgtgtgtctggcccatcacgtcatagccatgtggtttatcaggtgccgcctgccc
ttccggaaggattttgtccctttcatcactaagggcctgcggtccaatgtcctcttgtct
tttgatgacacccccgagaaggacagcttcagggcccggagtactagtctcaacgagagg
cccaagagtctgaggatagccagaccccccaaacaaggcttgaataactctccacccgtg
aaagaattcaaggagagctctgcagccgaggccttccggtgccgcagcatcagtgtgtct
gaacatgtggtccgcagcaggatacagacgtccctcaccagtgccagcctggggtctgca
gacgagaactccgtggcccaggctgacgatagcctgaaaagcctccatctggagctcacg
gaaacctgtctggacatgatggcccgatacgtcttctccaacttcacagctgtcccgaag
aggtctcctgtgggcgagttcctcctggcgggtggcaggaccaaaacctggctggttggg
aacaagcttgtcactgtgacgacgagtgtgggaaccgggacccggtcgttactaggcctg
gactcgggggagctgcagtccggcccggagtcgagctccagccccggcatgaatgtgaga
cagacgaaggaggcgccagccaagctggagtcccaggctgggcagcaggtgtcccgtggg
gcccgggaccgggtccgttctatgtcagggggccatggtcttcgagttggcgccctggat
gtgccggcctcccagttcccgggcagtgccgcttctccaggaccacagactgcaccagcc
gcgaagcctgagaaggcctcggccggcgcccggcttcctgtgcaggagaagacgaacctg
gccgcctacgtgcccctgctgacccagggctgggcggagatcctggtccggaggcccaca
gggaacaccagctggctgatgagcctggagaacccgctcagccctttctcctcggacatc
aacaacatgcccctgcaggagctgtccaacgccctcatggcagctgagcgcttcaaggag
caccgggacacagccctgtacaagtcgctgtcggtgccagcagccagcacggccaaaccc
cctcctctgcctcgctccaacacagtggcctctttctcctccctgtaccagtccagctgc
caaggacagctgcacaggagcgtttcctgggcagactccgccgtggtcatggaggaggga
agtcctggcgaggttcctgtgccagtggagcccccaggattggaggactttgaggcggcg
ctaggcgtggacaggcgcacagacgcctacagcaggtcgtcctcaacctccagccaggag
gagaagtcattccacgcagaggagctggttgccgggggaatccccattgaacgagccgtc
tcctcggagggtggccggccctctgtggacctctccttccagccctcacagcccctgagc
aagtctagctcctctcctgagctgcagaccctgcaggacatcctcggggaccctggggac
aaggctgacgtgggccggctgagccctgaggttaaggcccgttcacagtcagggatcctg
gacggggaaagtgctgcctggccagcctcgggcgaagacagtcggggccagcccgagggt
cccttgccttccagctccccccgctcacccagtggcctccggccccgcggttacaccatc
tccgactcggccccatcacgcaggggcaggagggtagaaagggatgcctttaagagcaga
gccacagcttccaatgcagagaaagtgccaggcatcaaccccagtttcgtgttcctgcag
ctctaccattcgcctttctttggcgacgagtcaaacaagccaatcctgctgcccaatgag
tcacagtcctttgagcggtcggtgcagctcctcgaccagatcccatcatacgacacccac
aagatcgccgtcctgtatgtgggagaaggccagagcaacagtgagctcgccatcctgtcc
aatgagcatggctcctacaggtacacggagttcctgacgggcctgggccggctcatcgag
ctcaaggactgccagccagacaaggtgtacctgggcggcctggacgtgtgtggtgaggac
ggccagttcacctactgctggcacgacgacatcatgcaagccgtcttccacatcgccacc
ctgatgcccaccaaggacgtggacaagcatcgttgcgacaagaagcgccacctgggcaac
gatttcgtgtccattgtctacaatgactctggcgaggacttcaagctcggcaccatcaag
ggccagttcaactttgtccacgtgatcatcaccccgctggattatgagtgcaacctggtg
tccctgcagtgcaggaaagacatggagggccttgtggacaccagcgtggccaagatcgtg
tctgaccgcaacctgccttttgtggcccgtcagatggccctgcatgcaaacatggcctca
caggtgcaccacagccgctccaaccccaccgacatctacccctccaagtggattgcccgg
ctccgccacatcaagagactccgccagcggatctgcgaggaagccgcctactccaacccc
agcctgcctctggtgcaccccccatcccataccaaagggcctgcacagactccagccgag
cccacgcctggctacgagatgggccagcggaagcgcctcatctcctctgtggaggacttc
accgagttcgtgtga

DBGET integrated database retrieval system