KEGG   Macaca mulatta (rhesus monkey): 695030Help
Entry
695030            CDS       T01028                                 

Gene name
MGAM
Definition
(RefSeq) maltase-glucoamylase
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00052  Galactose metabolism
mcc00500  Starch and sucrose metabolism
mcc01100  Metabolic pathways
mcc04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    695030 (MGAM)
   00500 Starch and sucrose metabolism
    695030 (MGAM)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    695030 (MGAM)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     695030 (MGAM)
    3.2.1.20  alpha-glucosidase
     695030 (MGAM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 695030
NCBI-ProteinID: XP_014990571
LinkDB All DBs
Position
3
AA seq 2142 aa AA seqDB search
MARKKLQKFTTLEIVLSVLLLVLFIISIVLIVLLAKESLKSTAPDPGTTGTPDPGTTTST
QSRTTGPPDPGTTGTTPVSAECPVVNELERINCIPDQPPTKATCDQRGCCWNPQGAVSVP
WCYYSKNHSYHMEGDLVNTNAGFTARLKNLPSSPVFGSNVDNVLLTAEYQTSNRFHFKLT
DQTSSRFEVPHEHVQSFSGNAAASLTYRVEISREPFSIKVTRRSNNRVLFDSSIGPLLFA
NQFLQLSTRLPSANVYGLGEHVHQQYRHDMNWKTWPIFNRDTTPNGNGSNLYGAQTFFLC
LEDASGLSFGVFLMNSNAMEVVLQPAPAITYRTTGGILDFYVFLGNTPEQVVQEYLELIG
RPALPSYWALGFHLSRYEYGTLDNMREVVERNRAAQLPYDVQHADIDYMDERRDFTYDPV
NFKGFPEFVNDLHKNGQKLVIIVDPAISNNSSSSKPYGPYDRGSDMKIWVNSSDGVTPLI
GEVWPGQTVFPDYTNPNCAVWWTKEFELFHNQVEFDGIWIDMNEVSNFVDGSVSGCSTNN
LNNPPFTPRVLDGYLFCKTLCMDAVQHWGKQYDVHNLYGYSMAVATAEAAKTVFPNNRSF
ILTRSTFAGSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGADICGFALDAPEE
LCRRWMQLGAFYPFSRNHNGQGFKDQDPASFGADSLLLNSSRHYLNIRYTLLPYLYTLFF
RAHSRGDTVARPLLHEFYEDNSTWDVHQQFLWGPGLLITPVLDEGAEKVMAYVPDAVWYD
YETGNQVRWRKQKVEMELPGDKIGLHLRGGYIFPTQQPNTTTLASRKNPLGLIIALDENK
EAKGELFWDDGETKDTVANKVYLLCEFSVTQNRLEVNISQSTYKDPNNLAFNEIKILGTE
EPSNVTVKHNGIPSQTSPTVTYDSNLKVAIITDINLLLGEAYTVEWDIKIRDDEKIDCYP
DENGASAENCAARGCIWEASNSSGVPFCYFVNDLYSVSNVQYSSHGATADISLKSSVYAS
AFPSTPVNPLRLDVTYHKNEMLQFKIYDPNNNRYEVPVPLNVPTVPSSTPEGQLYDVLIK
KNPFGVEIRRKSTGTIIWDSQLLGFTFNDMFIRISTRLASKYLYGFGETEHTSYRRDLEW
HTWGMFSRDQPPGYKKNSYGVHPYYMGLEEDGSAHGVFLLNSNAMDVTFQPLPALTYRTT
GGVLDFYVFLGPTPELVTQQYTELIGRPVMVPYWSLGFQLCRYGYQNDSEIASLYDEMVA
AQIPYDVQYSDIDYMERQLDFTLSPKFAGFPALINRMKADGMRVILILDPAISGNETQPY
PAFTRGLEDDVFIKYPNDGDIVWGKVWPDFPGVVVNDSLDWDSQVELYRAYVAFPDFFRN
STAKWWKREIEELYNNPQNPERSLKFDGLWIDMNEPSSFVNGAVSPGCRDTSLNRPPYMP
YLESRDRGLSSKTLCMESQQILPDGSPVQHYNVHNLYGWSQTRPTYEAMQEVTGQRGVVI
TRSTFPSSGRWAGHWLGDNTAAWDQLKKSIIGMMEFSLFGISYTGADICGFFQDAEYEMC
VRWMQLGAFYPFSRNHNTIGTRRQDPVSWDTAFVNISRNVLQTRYTLLPYLYTLIYKAHT
EGVTVVRPLLHEFVSDQVTWDIDSQFLLGPAFLVSPVLERNARNVTAYFPRARWYDYYTG
VDIDARGEWKTLPAPLDYINLHIRGGYILPWQEPAVNTHLSRKNPLGLIIALDENKEAKG
ELFWDDGQTKDTVANKVYLLCEFSVTQNRLEVNISQSTYKDPNNLAFNEIKILGTEEPSN
VTVKHNGVPSQTSPTVTYDSNLKVAIITDINLLLGEAYTVEWDIKTRDDEKIDCYPDENG
ASAENCIARGCIWEASNSSGVPFCYFVNDLYSVSNVQYNSHGATADISLKSSVYANAFPS
TPVNPLRLDVTYHKNEMLQFKIYDPNNNRYEVPVPLNVPMVPSGTPEGQLYDVLIKKNPF
GIEIRRRSTGTIIWDSQLLGFTFNDMFIRISTRLPSKYLYGFGETEHTSYRRDLEWHTWG
MFSRDQPPGYKKNSYGVHPYYMGLEEDGSAHGVFLLNSNAMDVTFQPLPALTYRTTGGVL
DFYVFLGPTPELVTQQYTEVGRNPVVYQALIQHILDARAHIH
NT seq 6429 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaaagaagctgcaaaaatttactactttggagattgtgctcagtgttcttctg
ctcgtgttgtttatcatcagtattgttctaattgtgcttttagccaaggagtcattgaaa
tcaacagccccagatcccgggacaactggtaccccagatcctggaacaaccacttccacg
cagtctaggacaactggtcccccagatcctggaacaactggtaccactcctgtttctgct
gaatgtcccgtggtaaatgaattggaacgaattaattgcatccctgaccagccaccaaca
aaggccacatgtgaccaacgtggctgttgctggaatccccagggagctgtaagtgttccc
tggtgctactattccaagaatcatagctaccacatggagggcgaccttgtaaacacaaat
gcaggattcacagcccggttgaaaaatctgccttcttcacccgtgttcggaagcaatgtt
gacaatgttcttctcacagcagaatatcagacatctaatcgtttccactttaagttgacc
gaccaaaccagtagcaggtttgaagtaccccacgaacatgtgcagtccttcagtggaaat
gctgctgcttctttgacctaccgagttgaaatctccagagagccatttagcatcaaagtg
accagaagaagcaacaatcgtgttttgtttgactcaagcattgggcccctcctgtttgcc
aaccagttcttgcagctttccacccgactgcctagtgctaatgtgtatggcctgggagag
catgtgcaccagcagtaccggcatgatatgaattggaagacctggcccatatttaacagg
gacacaactcccaatggaaacggaagtaatttgtatggtgcgcagacattcttcctgtgt
cttgaagatgctagtggattgtcctttggggtgtttctgatgaacagcaatgccatggag
gttgtccttcagcctgcgccagccatcacttaccgcaccactgggggcattctcgacttc
tatgtgttcttgggaaacactccagagcaagttgttcaagaatatctagagcttattggg
cggccagcccttccctcctactgggcacttggatttcaccttagtcgttatgaatatgga
accttagacaacatgagagaagtcgtggagagaaatcgcgcagcacagctcccttatgat
gttcagcatgctgatattgattatatggatgagagaagggacttcacttatgatccagtg
aattttaaaggcttccctgaatttgtcaatgacttacacaaaaatggacagaagcttgtc
atcattgtggatccagccatctccaacaactcttcctcaagtaaaccctatggcccatat
gacaggggttcagatatgaagatatgggtgaatagttcagatggagtgactccactcatt
ggggaggtctggcctggacaaactgtgtttcctgattataccaatcccaactgtgctgtt
tggtggacaaaggaatttgaactttttcataatcaagtggagtttgatggaatctggatt
gatatgaatgaagtctccaactttgttgatggttcggtctcaggatgttccacaaacaac
ctaaataatcccccattcactcccagagtcctggatgggtacctgttctgcaagactctc
tgtatggatgcagtgcagcactggggcaagcagtatgacgttcacaatctgtatggctac
tccatggcggttgccacagcagaagctgccaagactgtgttccctaataacagaagcttc
attctgacccgttctacctttgcgggttctggcaagtttgcagcacattggttaggagac
aacaccgccacctgggatgacctgcgatggtccatccctggcgtccttgagttcaacctt
ttcggcatcccaatggtgggtgctgacatatgtggctttgccttggatgcccctgaggag
ctctgtaggcggtggatgcagttgggcgcattttatccattttctagaaatcacaatggc
caaggcttcaaggaccaggatcctgcctcctttggagctgactccctgctgttgaattcc
tccaggcactaccttaacatccgctatactctattgccctacctatacaccctcttcttc
cgtgctcacagccgaggggacacggtggccaggccccttttgcatgagttctatgaggac
aacagcacttgggatgtgcaccaacagttcttatgggggcccggcctcctcatcactcca
gttctggatgaaggtgcagagaaagtgatggcatatgtgcctgatgctgtctggtatgac
tacgagactggaaaccaagtgagatggaggaagcaaaaagtcgagatggaacttcctgga
gacaaaattggacttcaccttcgaggaggctacatctttcccacacagcagccaaataca
accactctggccagtcgaaagaaccctcttggtcttatcattgccctagatgagaacaaa
gaagcaaaaggagaacttttctgggatgatggggaaacgaaggatactgtggccaataaa
gtgtatcttttatgtgagttttctgtcactcaaaaccgcttggaggtgaatatttcacaa
tcaacctacaaggaccccaataatttagcatttaatgagattaaaattcttgggacggag
gaacctagcaatgttacagtgaaacacaatggtatcccaagtcagacttctcctacagtc
acttatgattctaacctgaaggttgccattatcacagatatcaatcttctcctgggagaa
gcatacacagtggagtgggatataaagataagggatgatgaaaaaatagactgttaccct
gatgagaatggggcttctgcagaaaactgtgctgcccgtggctgtatctgggaggcatcc
aattcttctggggtccctttttgctattttgtcaacgatctatactctgtcagtaatgtt
caatatagttcacatggggccacagctgacatctccttaaagtcttccgtgtatgccagt
gccttcccctccacacccgtgaacccccttcgcctggatgtcacttaccataagaatgaa
atgctgcagttcaagatttatgatcccaacaacaatcggtatgaagttccagttcctctg
aacgtacccacggtgccatccagcacccctgagggtcaactctatgatgtccttattaag
aagaatccgtttggggttgaaattcgccgcaagagtacaggcactataatttgggactct
cagctccttggtttcaccttcaatgacatgtttatccgcatctccacccgccttgcctcc
aagtacctctatggctttggggaaactgagcacacatcctataggagagacttggagtgg
cacacttgggggatgttctcccgagaccagcccccagggtacaagaagaattcctatggt
gtccacccctactacatggggctggaggaggatggcagtgcccacggagtgttcctgctg
aacagcaatgccatggacgtgacgttccagcccctgcctgccttgacataccgtaccaca
gggggagttctggacttttatgtgttcttggggccaactccagagcttgtcacccagcag
tacacggagttgattggccggcctgtgatggtaccttactggtctttgggtttccagctg
tgtcgctatggataccagaacgactctgagatcgccagcttgtatgatgagatggtggcc
gcccagatcccttatgacgtgcagtactcagacatcgactacatggagcggcagctggac
ttcaccctcagccccaagtttgctgggtttccagctctgatcaatcgcatgaaggctgat
gggatgcgggtcatcctcattctggatccagctatttctggcaatgagacacagccctat
cctgccttcactcggggcttggaggatgacgtcttcatcaaatacccaaatgatggagac
attgtctggggaaaggtctggcccgattttcctggtgttgttgtgaatgactctctagac
tgggacagtcaagtggagctatatcgagcttacgtggccttcccagactttttccgtaat
tcaactgccaagtggtggaagagggaaatagaagaactgtacaacaatccacagaatcca
gagaggagcttgaagtttgatggcctgtggattgatatgaatgaaccatcaagcttcgtg
aatggggcagtttctccaggctgcagggacacctctctgaaccgccctccctacatgcca
tatttggagtccagggacaggggtctaagcagcaagaccctgtgcatggagagtcagcag
atcctcccagacggctccccggtgcagcactacaacgtgcacaacctgtacgggtggtcc
cagaccagacccacatacgaagccatgcaggaggtgacgggacagcgaggggtcgtcatc
acccgctccacatttccctcttctggccgctgggcaggacattggctgggagacaacacg
gccgcgtgggatcagctgaagaaatctatcattggcatgatggagttcagcctcttcggc
atatcctatacaggagcagatatctgtgggttctttcaagatgctgaatacgagatgtgt
gttcgctggatgcagctgggggccttttaccccttctcaagaaaccacaacaccattggg
accaggagacaagaccctgtgtcctgggatactgcttttgtgaacatttccagaaatgtc
ctgcagaccagatacaccctgttgccatatctgtataccttgatatataaggcccacacg
gagggcgtcacggttgtgcggcctctgcttcatgagtttgtgtcagaccaggtgacgtgg
gacatagacagtcagttcctgctgggcccagccttcctggtcagccctgtcctggagcgc
aatgccagaaatgtcactgcatatttccctagagcccgctggtacgattactacacgggt
gtggatattgatgcaagaggagagtggaagaccttgccagcccctcttgactacattaat
cttcatatccgtgggggctacatcctgccctggcaagagcctgcagtgaacacccactta
agtcgaaagaaccctcttggtcttatcattgccctagatgagaacaaagaagcaaaagga
gaacttttctgggatgatgggcaaacgaaggatactgtggccaataaagtgtatctttta
tgtgagttttctgtcactcaaaaccgcttggaggtgaatatttcacaatcaacctacaag
gaccccaataatttagcatttaatgagattaaaattcttgggacggaggaacctagcaat
gttacagtgaaacacaatggtgtcccaagtcagacttctcctacagtcacttatgattct
aacctgaaggttgccattatcacagacatcaatcttctcctgggagaagcatacacagtg
gagtgggatataaagacaagggatgatgaaaaaatagactgttaccctgatgagaatggc
gcttctgcagaaaactgcattgcccgtggctgtatctgggaggcatccaattcttctgga
gtccctttttgctattttgtcaacgatctatactctgtcagtaatgttcaatataattca
catggggccacagctgacatctccttaaagtcttccgtgtatgccaatgccttcccctcc
acacccgtgaacccccttcgcctggatgtcacttaccataagaatgaaatgctgcagttc
aagatttatgatcccaacaacaatcggtatgaagttccagttcctctgaacgtacccatg
gtgccatccggcacccctgagggtcaactctatgatgtcctcattaagaagaatccattt
gggattgaaattcgccgcaggagtacaggcactataatttgggactctcagctccttggc
ttcaccttcaatgacatgtttatccgcatctccacccgccttccctccaagtacctctat
ggctttggggaaactgagcacacatcctataggagagacttggagtggcacacttggggg
atgttctcccgagaccagcccccagggtacaagaagaattcctatggggtccacccctac
tacatggggctggaggaggacggcagtgcccacggagtgttcctgctgaacagcaatgcc
atggacgtgacgttccagcccctgcctgccttgacataccgtaccacagggggagttctg
gacttttatgtgttcttggggccaactccagagcttgtcacccagcagtacacggaggta
ggaagaaatccagttgtttatcaagcacttatacagcacattctggatgccagagcccac
atccattag

DBGET integrated database retrieval system