KEGG   Macaca mulatta (rhesus monkey): 695207Help
Entry
695207            CDS       T01028                                 

Gene name
WBSCR17
Definition
(RefSeq) Williams-Beuren syndrome chromosome region 17
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00512  Mucin type O-glycan biosynthesis
mcc01100  Metabolic pathways
Module
mcc_M00056  O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    695207 (WBSCR17)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mcc01003]
    695207 (WBSCR17)
Enzymes [BR:mcc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     695207 (WBSCR17)
Glycosyltransferases [BR:mcc01003]
 O-Glycan biosynthesis
  Mucin-type
   695207 (WBSCR17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin RicinB_lectin_2 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 695207
NCBI-ProteinID: NP_001252818
Ensembl: ENSMMUG00000022555
UniProt: F6Y9A8
LinkDB All DBs
Position
3
AA seq 598 aa AA seqDB search
MASLRRVKVLLVLNLIAVAGFVLFLAKCRPIAVRSGDAFHEIRPRAEVANLSAHSASPIQ
DAVLKRLSLLEDIVYRQLNGLSKSLGLIEGYGGRGKGGLPATLSPAEEEKAKGPHEKYGY
NSYLSEKISLDRSIPDYRPTKCKELKYSKDLPQISIIFIFVNEALSVILRSVHSAVNHTP
THLLKEIILVDDNSDEEELKVPLEEYVHKRYPGLVKVVRNQKREGLIRARIEGWKVATGQ
VTGFFDAHVEFTAGWAEPVLSRIQENRKRVILPSIDNIKQDNFEVQRYENSAHGYSWELW
CMYISPPKDWWDAGDPSLPIRTPAMIGCSFVVNRKFFGEIGLLDPGMDVYGGENIELGIK
VWLCGGSMEVLPCSRVAHIERKKKPYNSNIGFYTKRNALRVAEVWMDDYKSHVYIAWNLP
LENPGIDIGDVSERRALRKSLKCKNFQWYLDHVYPEMRRYNNTVAYGELRNNKAKDVCLD
QGPLENHTAILYPCHGWGPQLARYTKEGFLHLGALGTTTLLPDTRCLVDNSKSRLPQLLD
CDKVKSSLYKRWNFIQNGAIMNKGTGRCLEVENRGLAGIDLILRSCTGQRWTIKNSIK
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atggcttcactgagaagagtcaaagtgctgctggtgttgaacttgatcgcggtagccggc
ttcgtgctcttcctggccaagtgccggcccatcgcggtgcgcagcggagacgccttccac
gagatccggccgcgcgccgaggtggccaacctcagcgcgcacagcgccagccccatccag
gatgcggtcctgaagcgcctgtcgctgctggaggacatagtgtaccggcagctgaatggc
ttatccaaatcccttgggctcattgaaggttatggtgggcggggtaaagggggcctcccg
gctactctttccccagctgaagaagaaaaggctaagggaccccatgagaagtatggctac
aattcctacctcagtgagaaaatttcactggaccgttccattccggattatcgtcccacc
aagtgtaaggagctcaagtactccaaggacctgccccagatatccatcatattcatcttc
gtgaacgaggccctgtcggtgatcctgcggtcagtgcacagtgccgtcaatcacacaccc
acacacctgctgaaggaaatcattctggtggatgacaacagcgacgaagaggagctgaag
gtccccctggaggagtatgtccacaaacgctaccccgggctggtgaaggtggtgagaaat
cagaagagggaaggcctgatccgcgctcgcattgagggctggaaggtggccaccgggcag
gtcactggcttctttgatgcccacgtggaattcaccgctggctgggctgagccggttcta
tcccgcatccaggaaaaccggaagcgtgtgatcctcccctccattgacaacatcaaacag
gacaactttgaggtgcagcggtacgagaactcggcccatgggtacagctgggagctgtgg
tgcatgtacatcagccccccaaaagactggtgggacgccggagacccttctctccccata
aggaccccagccatgataggctgctcgtttgtggtcaacaggaagttcttcggtgaaatc
ggtcttctggatcctggcatggatgtgtacggaggagaaaatattgaactaggaatcaag
gtatggctctgtgggggcagcatggaggtccttccttgctcacgggtggcccacattgag
cggaagaagaagccatataatagcaacatcggcttctacaccaagaggaatgctctccgc
gttgctgaggtctggatggacgattataagtctcatgtgtacatagcgtggaacctgccg
ctggagaatccgggaattgacatcggtgatgtctctgaaagaagagccttaaggaaaagt
ttaaagtgtaagaatttccagtggtacctggaccatgtttacccagaaatgagaagatac
aataataccgttgcttacggggagcttcgcaacaacaaggcaaaagacgtctgcttggac
caggggccactggagaaccacacagcaatactgtatccgtgccatggctggggaccgcag
cttgcccgctacaccaaggaaggctttctgcacttgggcgccctggggaccaccacactc
ctccctgacacccgctgcctggtagataactctaagagtcggctgccgcagctcctggac
tgcgacaaggtcaagagcagcctgtacaagcgctggaacttcatccagaacggagccatc
atgaacaagggcacgggacgctgcctggaggtggagaaccggggcctggctggcatcgac
ctcatcctccgcagctgcacaggtcagaggtggaccattaagaactccatcaagtag

DBGET integrated database retrieval system