KEGG   Macaca mulatta (rhesus monkey): 695250
Entry
695250            CDS       T01028                                 

Gene name
ARRB1
Definition
(RefSeq) beta-arrestin-1 isoform X4
  KO
K04439  beta-arrestin
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04010  MAPK signaling pathway
mcc04062  Chemokine signaling pathway
mcc04144  Endocytosis
mcc04340  Hedgehog signaling pathway
mcc04728  Dopaminergic synapse
mcc04740  Olfactory transduction
mcc04926  Relaxin signaling pathway
mcc04928  Parathyroid hormone synthesis, secretion and action
mcc04929  GnRH secretion
mcc05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    695250 (ARRB1)
   04340 Hedgehog signaling pathway
    695250 (ARRB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    695250 (ARRB1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    695250 (ARRB1)
  09152 Endocrine system
   04929 GnRH secretion
    695250 (ARRB1)
   04926 Relaxin signaling pathway
    695250 (ARRB1)
   04928 Parathyroid hormone synthesis, secretion and action
    695250 (ARRB1)
  09156 Nervous system
   04728 Dopaminergic synapse
    695250 (ARRB1)
  09157 Sensory system
   04740 Olfactory transduction
    695250 (ARRB1)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    695250 (ARRB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    695250 (ARRB1)
Membrane trafficking [BR:mcc04131]
 Endocytosis
  Clathrin-mediated endocytosis
   GPCR adaptor proteins
    695250 (ARRB1)
SSDB
Motif
Pfam: Arrestin_N Arrestin_C AP3B1_C LDB19
Other DBs
NCBI-GeneID: 695250
NCBI-ProteinID: XP_014970698
Ensembl: ENSMMUG00000017529
UniProt: H9FUE8
LinkDB
Position
14
AA seq 418 aa
MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCA
FRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIP
PNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGP
QPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYAD
ICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNL
ASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEP
LHREVPENQTPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEEEENGTGSPQLNNR
NT seq 1257 nt   +upstreamnt  +downstreamnt
atgggcgacaaagggacccgagtgttcaagaaggccagtccgaatggaaagctcaccgtc
tacctgggaaagcgggactttgtggaccacatcgacctcgtggaccctgtggatggtgtg
gtcctggtggatcctgagtatctcaaagagaggagagtctatgtgacgctgacctgcgcc
ttccgctatggccgggaggacctggatgtcctgggcctgacctttcgcaaggacttgttt
gtggccaacgtgcagtccttcccaccagcccccgaggacaagaagcccctgacgcggctg
caggagcgcctcatcaagaagttgggcgagcacgcctaccctttcacctttgagatccct
ccaaaccttccatgctctgtgacactgcagccggggcccgaagacacagggaaggcttgc
ggtgtggactatgaagtcaaagccttctgtgcggagaatttggaggagaagatccacaag
cggaattctgtgcgtctggtcatccggaaggttcaatatgccccagagaggcctggcccc
cagcccacagccgagaccaccaggcagttcctcatgtcggacaagcccttgcacctagag
gcctccctggataaggagatctattaccatggagaacccatcagtgtcaacgtccacgtc
accaacaacaccaacaagacggtgaagaagatcaagatctcagtgcgccagtatgcagac
atctgccttttcaacacagctcagtacaagtgccctgttgccatggaagaggctgatgac
actgtggcacccagctcgacgttctgcaaggtctacacactgacccccttcctagccaat
aaccgagagaagcgaggcctcgccttggacgggaagctcaagcatgaagacacgaacttg
gcctctagcaccctgttgagggaaggcgccaaccgtgagatcctggggatcattgtttcc
tacaaagtgaaagtaaagctggtggtgtctcggggcggcctgttgggagatcttgcatcc
agtgatgtggctgtggaactgcctttcaccctaatgcaccccaagcccaaagaggaaccc
ctgcatcgggaagttccagagaaccagacgccagtagataccaatctcatagaacttgac
acaaatgatgacgacattgtatttgaggactttgcccgccagagactgaaaggcatgaag
gatgacaaggaggaagaggagaatggtaccggctctccacagctcaacaacagatag

KEGG   Macaca mulatta (rhesus monkey): 709399
Entry
709399            CDS       T01028                                 

Gene name
ARRB2
Definition
(RefSeq) beta-arrestin-2 isoform X1
  KO
K04439  beta-arrestin
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04010  MAPK signaling pathway
mcc04062  Chemokine signaling pathway
mcc04144  Endocytosis
mcc04340  Hedgehog signaling pathway
mcc04728  Dopaminergic synapse
mcc04740  Olfactory transduction
mcc04926  Relaxin signaling pathway
mcc04928  Parathyroid hormone synthesis, secretion and action
mcc04929  GnRH secretion
mcc05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    709399 (ARRB2)
   04340 Hedgehog signaling pathway
    709399 (ARRB2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    709399 (ARRB2)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    709399 (ARRB2)
  09152 Endocrine system
   04929 GnRH secretion
    709399 (ARRB2)
   04926 Relaxin signaling pathway
    709399 (ARRB2)
   04928 Parathyroid hormone synthesis, secretion and action
    709399 (ARRB2)
  09156 Nervous system
   04728 Dopaminergic synapse
    709399 (ARRB2)
  09157 Sensory system
   04740 Olfactory transduction
    709399 (ARRB2)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    709399 (ARRB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    709399 (ARRB2)
Membrane trafficking [BR:mcc04131]
 Endocytosis
  Clathrin-mediated endocytosis
   GPCR adaptor proteins
    709399 (ARRB2)
SSDB
Motif
Pfam: Arrestin_N Arrestin_C SCA7
Other DBs
NCBI-GeneID: 709399
NCBI-ProteinID: XP_014973815
Ensembl: ENSMMUG00000017654
UniProt: A0A5F7ZE43
LinkDB
Position
16
AA seq 440 aa
MGGGSGRGLGRSQTRTPRRGSGGRTPGSLGTAIRGRTRRVFKKSSPNCKLTVYLGKRDFV
DHLDKVDPVDGVVLVDPDYLKDRKVFVTLTCAFRYGREDLDVLGLSFRKDLFIATYQAFP
PVPNPPRPATRLQDRLLRKLGQHAHPFFFTIPQNLPCSVTLQPGPEDTGKACGVDFEIRA
FCAKSLEEKSHKRNSVRLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELY
YHGEPLNVNVHVTNNSTKTVKKIKVSVRQYADICLFSTAQYKCPVAQLEQDDQVSPSSTF
CKVYTITPLLSDNREKRGLALDGKLKHEDTNLASSTIVKEGANKEVLGILVSYRVKVKLV
VSRGGDVSVELPFVLMHPKPRDHTPLPRPQSAAPETDVPVDTNLIEFDTNYATDDDIVFE
DFARLRLKGMKDDDYDDQLC
NT seq 1323 nt   +upstreamnt  +downstreamnt
atgggcggcggctcggggcgggggctgggacggtcccagacgaggacgccgcggagagga
tctgggggccggacgcctgggtccctagggacagccatccggggccgcacgcgcagggtc
ttcaagaagtcgagccctaactgcaagctcaccgtgtacttgggcaagcgggacttcgta
gatcacctggacaaggtggaccctgtagatggcgtggtgcttgtggaccctgactacctg
aaggaccgcaaagtgtttgtgaccctcacctgcgccttccgctatggccgtgaagacctg
gatgtgctgggcttgtccttccgtaaagacctgttcatcgccacctaccaggccttcccc
ccggtgcccaacccgccccggcctgccacccgcctgcaggaccggctgctgaggaagctt
ggccagcatgcacaccccttcttcttcaccataccccagaatcttccatgctctgtcaca
ctgcagccaggaccagaggacacagggaaggcctgcggcgtagactttgagattcgagcc
ttctgtgctaaatcactagaggagaaaagccacaaaaggaactctgtgcgactggtgatc
cgaaaggtgcagtttgccccagagaaacccggcccccagccttcagcagaaaccacacgc
cacttcctcatgtctgaccggtccctgcacctcgaggcttccctggacaaggagctgtac
taccatggggagcccctcaatgtaaatgtccacgtcaccaacaactccaccaagaccgtc
aagaagatcaaagtctctgtgagacagtacgccgacatctgcctcttcagcaccgcccag
tacaagtgtcctgtggctcaactcgaacaagatgaccaggtatctcccagctccacgttc
tgtaaggtgtacaccatcaccccgctgctcagtgacaaccgggagaagcggggtctcgcc
ctggatgggaaactcaaacacgaggacaccaacctggcttccagcaccatcgtgaaggag
ggtgccaacaaggaggtgctgggaatcctggtgtcctacagggtcaaggtgaagctggtg
gtgtctcgaggcggggatgtgtctgtggagctgccttttgttcttatgcaccccaagccc
cgcgaccacacccccctccccagaccccagtcagccgctccggagacagacgtccccgtg
gacaccaacctcattgaatttgataccaactatgccacagatgatgacattgtgtttgag
gactttgcccggcttcggctgaaggggatgaaggatgacgactatgatgaccaactctgc
tag

DBGET integrated database retrieval system