KEGG   Macaca mulatta (rhesus monkey): 695286
Entry
695286            CDS       T01028                                 

Gene name
STAM2
Definition
(RefSeq) signal transducing adapter molecule 2
  KO
K04705  signal transducing adaptor molecule
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04144  Endocytosis
mcc04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    695286 (STAM2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    695286 (STAM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    695286 (STAM2)
Membrane trafficking [BR:mcc04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-0 complex
    695286 (STAM2)
SSDB
Motif
Pfam: VHS SH3_1 SH3_9 SH3_2 UIM GAT ENTH
Other DBs
NCBI-GeneID: 695286
NCBI-ProteinID: XP_014965608
Ensembl: ENSMMUG00000010527
UniProt: F7GA07
LinkDB
Position
12
AA seq 525 aa
MPLFTANPFEQDVEKATNEYNTTEDWSLIMDICDKVGSTPNGAKDCLKAIMKRVNHKVPH
VALQALTLLGACVANCGKIFHLEVCSRDFATEVRAVIKNKAHPKVCEKLKSLMVEWSEEF
QKDPQFSLISATIKSMKEEGITFPPAGSQTVSAAAKNGTSSNKNKEDEDIAKAIELSLQE
QKQQHTETKSLYPSAEIQLNNKVARKVRALYDFEAVEDNELTFKHGEIIIVLDDSDANWW
KGENHRGIGLFPSNFVTTNLNVETEAAAVDKLNVIDDDVEEIKKSEPEPVYIDEDKMDRA
LQVLQSIDPTDSKPDSQDLLDLEDICQQMGPMIDEKLEEIDRKHSELSELNVKVLEALEL
YNKLVNEAPVYSVYSKLHPPAHYPPASSGVPMQTYPVQSHGGNYMGQSIHQVTVAQSYSL
GPDQIGPLRSLPPNVNSSVTTQPAQTSYLSTGQDTVSNPTYMNQNSNLQSATGTTAYTQQ
MGMSVDMSSYQNTTSNLPQLAGFPVTVPAHPVAQQHTNYHQQPLL
NT seq 1578 nt   +upstreamnt  +downstreamnt
atgcctttgttcaccgccaaccccttcgagcaagacgtggaaaaagccacgaatgagtac
aacactacagaagattggagtcttattatggacatatgtgacaaagttggaagtactcct
aatggagcgaaagattgcctaaaagccataatgaaaagggtaaatcataaggttccacat
gttgctctgcaggcactaacccttcttggggcttgtgtggcaaactgtggaaagatattt
catttagaagtatgttcccgtgattttgcaacagaagtacgtgctgtgattaaaaataag
gcacatcctaaagtatgtgaaaaactgaaatctttaatggtggagtggtcagaagaattt
cagaaggaccctcagtttagtctaatatctgcaactattaaatctatgaaagaggaagga
attacttttcctccagcaggttctcagactgtctcagctgccgccaagaatggtacgtca
tcgaacaaaaacaaagaggatgaagacatagctaaagctattgaattatcgctgcaagaa
cagaaacagcaacacacagaaacaaaatccttatatccatctgcagaaattcagttaaat
aataaggttgcacggaaagtgagagctttatatgattttgaagctgttgaggacaatgaa
ctcacctttaaacatggtgaaataattattgttttggatgacagtgatgccaattggtgg
aaaggagaaaatcacagaggaataggacttttcccatccaattttgtaacaactaattta
aacgtagagactgaggcagcggctgtggacaaattgaatgtaattgatgatgatgtggag
gaaattaagaaatcagagcctgagcctgtttatatagatgaggataagatggatagagcc
ctgcaggtacttcagagtatagatccaacagattcaaaaccagactcccaagaccttttg
gatttagaagatatctgccaacagatgggtccaatgatagatgaaaaactcgaagaaatt
gataggaagcattcagagttgtctgaattgaatgtaaaagtcctggaagctctggaacta
tataacaaattggtgaatgaagcaccagtgtactcagtctattcaaagctccaccctcca
gcacattacccacctgcatcatccggggttccaatgcagacatatccagttcaatcacat
ggtggaaactatatgggtcagagcattcaccaagtaactgttgcccaaagctatagccta
ggacccgatcagattggtccactgagatctctgcctccaaatgtgaattcctcagtgaca
acacagcctgctcaaacttcatatttaagcactggacaagacactgtttccaatcctact
tatatgaaccagaactctaacctacagtcagctactggtacaactgcttacactcagcaa
atggggatgtctgtggatatgtcatcttatcagaacactacttccaatttgcctcaactg
gcaggctttccggtgacagttccagctcatccagttgcacagcagcacacaaattaccat
cagcagcctctcctttag

KEGG   Macaca mulatta (rhesus monkey): 706026
Entry
706026            CDS       T01028                                 

Gene name
STAM
Definition
(RefSeq) signal transducing adapter molecule 1 isoform X1
  KO
K04705  signal transducing adaptor molecule
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04144  Endocytosis
mcc04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    706026 (STAM)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    706026 (STAM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    706026 (STAM)
Membrane trafficking [BR:mcc04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-0 complex
    706026 (STAM)
SSDB
Motif
Pfam: VHS SH3_1 SH3_9 SH3_2 UIM GAT SH3_10
Other DBs
NCBI-GeneID: 706026
NCBI-ProteinID: XP_015002052
Ensembl: ENSMMUG00000001700
UniProt: G7N1N9 H9ESU1
LinkDB
Position
9
AA seq 540 aa
MPLFATNPFDQDVEKATSEMNTAEDWGLILDICDKVGQSRTGPKDCLRSIMRRVNHKDPH
VAMQALTLLGACVSNCGKIFHLEVCSRDFASEVSNVLNKGHPKVCEKLKALMVEWTDEFK
NDPQLSLISAMIKNLKEQGVTFPAIGSQAAEQAKASPALAAKDPGTVANKKEEEDLAKAI
ELSLKEQRQQSTTLSTLYPSTSNLLTNHQHEGRKVRAIYDFEAAEDNELTFKAGEIITVL
DDSDPNWWKGETHQGIGLFPSNFVTADLTAEPEMIKTEKKTVQFSDDVQVETIEPEPEPA
FIDEDKMDQLLQMLQSTDPSDDQPDLPELLHLEAMCHQMGPLIDEKLEDIDRKHSELSEL
NVKVMEALSLYTKLMNEDPMYSMYAKLQNQPYYMQSSGVSGSQVYAGPPPSGAYLVAGNA
QMSHLQSYSLPPEQLSSLSQAVVPPSANPALPSQQTQAAYPNTMVSSVQGNTYPSQAPVY
SPPPAATAAAATADVTLYQNAGPSMSQVPNYNLTSSTLPQPGGSQQPPQPQQPYSQKALL
NT seq 1623 nt   +upstreamnt  +downstreamnt
atgcctctctttgccaccaatcccttcgatcaggatgttgagaaagcaaccagcgagatg
aatactgctgaggactggggcctcattttggatatctgtgataaagttggtcagtctcgc
actggacctaaggattgtcttcggtctattatgagaagagtgaaccacaaagatcctcac
gttgctatgcaggctttgactcttctaggagcatgtgtatcaaactgtggcaaaattttt
catttagaagtgtgttcaagagattttgctagtgaagtaagcaacgtattaaataagggt
catcctaaagtatgtgaaaaattaaaggctcttatggttgaatggacagatgaatttaag
aatgatccacagcttagtctaatatcagcaatgattaagaatcttaaggagcaaggagtt
acgttcccagctattggctctcaggctgcagaacaagcaaaagcaagcccagctcttgca
gccaaggatcctggtactgtggctaataaaaaagaagaagaagatttagcaaaagccatt
gagttgtctctcaaggaacaaaggcagcagtcaaccaccctttccactttgtatccaagc
acatccaacctcttaactaaccaccaacatgaaggccgaaaagttcgtgctatatatgac
tttgaagctgctgaagataatgaacttacttttaaagctggagaaattattacagttctt
gatgacagtgatcctaactggtggaaaggtgaaacccatcaaggcatagggttatttcca
tctaattttgtgacagcagatctcactgctgaaccagaaatgattaaaacagagaagaag
acggtacaatttagtgatgatgttcaggtagagacaatagaaccagagccggaaccagcc
tttattgatgaagataaaatggaccagttgctacagatgttgcaaagtacagaccccagt
gacgatcagccagacctcccagagctacttcatcttgaagcaatgtgtcaccagatgggc
cctctcattgatgaaaagctggaagatattgatagaaaacattcagaactctcagaactt
aatgtgaaagtgatggaggcactttccttatataccaagttaatgaacgaagatccgatg
tattccatgtatgcaaagttacagaatcagccatattatatgcagtcgtctggtgtttct
ggttctcaggtgtatgcagggcctcctccaagtggtgcctacctggttgcagggaatgcg
cagatgagccacctccagagctacagtcttcccccggagcagctgtcttctctcagccag
gcagtcgtcccgccgtccgcaaacccagcccttcctagtcagcagactcaggctgcttac
ccaaatacaatggtgagttctgttcaaggaaacacgtatcccagccaggcgccggtatat
agtcctcctcctgccgctactgctgctgcagcaactgccgatgtcactctgtaccagaat
gcaggacctagtatgtcccaggtgccaaactataacttaacctcatcaaccctgcctcag
ccgggaggcagccaacagccgcctcagccacagcaaccgtattctcagaaggctctgcta
tag

DBGET integrated database retrieval system