KEGG   Macaca mulatta (rhesus monkey): 695382
Entry
695382            CDS       T01028                                 

Gene name
RASSF5
Definition
(RefSeq) ras association domain-containing protein 5 isoform X1
  KO
K08015  Ras association domain-containing protein 5
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04218  Cellular senescence
mcc04670  Leukocyte transendothelial migration
mcc05200  Pathways in cancer
mcc05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    695382 (RASSF5)
   04015 Rap1 signaling pathway
    695382 (RASSF5)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    695382 (RASSF5)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    695382 (RASSF5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    695382 (RASSF5)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    695382 (RASSF5)
SSDB
Motif
Pfam: Nore1-SARAH RA C1_1 C1_2 PHD
Other DBs
NCBI-GeneID: 695382
NCBI-ProteinID: XP_001087653
Ensembl: ENSMMUG00000045607
UniProt: F7HC98
LinkDB
Position
1
AA seq 418 aa
MAMASSAIGQRPYPILLDPEPPHYLQSLSGPEPPPPPPDRSSRRCVPAPLSTAPGAHEGR
SARRAARGNLEPPTRASRPARPLRPGLQQRLRRRPGAPRPRDVRSIFEQPQDPRVPAERG
EGHCFAELVLPGGPGWCDLCGREVLRQALRCANCKFTCHPECRSLIRLDCSQQEGSSRDR
PSPESTLTLTFSQNVCKPVEETQRPPTLQEIKQKIDSYNTREKNCLGMKLSEDGTYTGFI
KVHLKLRRPVTVPAGIRPQSIYDAIKEVNLAATTDKRTSFYLPLDAIKQLHISSTTTVSE
VIQGLLKKFMVVDNPQKFALFKRIHKDGQVLFQKLSIADRPLYLRLLAGPDTEVLSFVLK
ENETGEVEWDAFSIPELQNFLTILEKEEQDKIQQVQKKYDKFRQKLEEALRESQGKPG
NT seq 1257 nt   +upstreamnt  +downstreamnt
atggccatggcgtcctcggccatcgggcagcgcccgtacccgatactcttggaccccgag
ccgcctcactatctacagagcctgagcggccccgagccgccgccgccgccccccgaccgg
tcctcgcgccgctgtgtcccggcgcccctctccactgcgcccggggcgcacgaggggcgc
agcgcccggagggctgcccgggggaacctggagcccccaacccgggcctcccgacccgct
cgcccgctccggcctggtctgcagcagagactgcggcggcggcctggagcgccccgaccc
cgcgacgtgaggagcatcttcgagcagccgcaggatccccgagtcccggcggagcgaggc
gaggggcactgcttcgcggaattggtgctgccgggcggccccggctggtgtgacctgtgt
ggacgagaggtgctgcggcaggcgctgcgctgcgctaactgtaaattcacctgtcaccca
gaatgccgcagcctgatccggttggactgcagtcagcaggagggttcatcccgggacaga
ccctctccagaaagcaccctcaccctgaccttcagccagaatgtctgcaaacctgtggag
gagacacagcgcccacccacactgcaggagatcaagcagaagattgacagctacaacacg
cgagagaagaactgcctgggcatgaagctgagtgaagacggcacctacacgggtttcatc
aaagtgcatctgaaactccggcggcctgtgacggtgcctgctgggatccggccccagtcc
atctatgatgccatcaaggaggtgaacctggcagccaccacggacaagcggacatccttc
tacctgcccctagatgccatcaagcagctgcacatcagcagcaccaccaccgtcagtgag
gtcatccaggggctgctcaagaagttcatggttgtggacaatccccagaagtttgcactt
tttaagcggatacacaaggacggacaagtgctcttccagaaactctccattgccgaccgc
cccctctacctgcgcctgcttgctgggcctgacacggaagtcctcagctttgtgctaaag
gagaatgaaactggagaggtggagtgggatgccttctccatccctgaacttcagaacttc
ctaacaatcctggaaaaagaggagcaggacaaaatccaacaagtgcaaaagaagtatgac
aagtttaggcagaaactggaggaggccttaagagaatcccagggcaaacctgggtaa

DBGET integrated database retrieval system