KEGG   Macaca mulatta (rhesus monkey): 695537
Entry
695537            CDS       T01028                                 

Gene name
MITF
Definition
(RefSeq) microphthalmia-associated transcription factor
  KO
K09455  microphthalmia-associated transcription factor
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04137  Mitophagy - animal
mcc04380  Osteoclast differentiation
mcc04916  Melanogenesis
mcc05200  Pathways in cancer
mcc05202  Transcriptional misregulation in cancer
mcc05218  Melanoma
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    695537 (MITF)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    695537 (MITF)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    695537 (MITF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    695537 (MITF)
   05202 Transcriptional misregulation in cancer
    695537 (MITF)
  09162 Cancer: specific types
   05218 Melanoma
    695537 (MITF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcc03000]
    695537 (MITF)
Transcription factors [BR:mcc03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Ubiquitous bHLH-ZIP factors
    695537 (MITF)
SSDB
Motif
Pfam: MITF_TFEB_C_3_N DUF3371 HLH DUF726
Other DBs
NCBI-GeneID: 695537
NCBI-ProteinID: NP_001253786
Ensembl: ENSMMUG00000002100
UniProt: I2CV82
LinkDB
Position
2
AA seq 504 aa
MEALRVQMFMPCSFESLYLSSAEHPGASKPPISSSSMTSRILLRQQLMREQMQEQERREQ
QQKLQAAQFMQQRVPVSQTPAINVSVPTTLPSATQVPMEVLKVQTHLENPTKYHIQQAQR
QQVKQYLSTTLANKHANQVLSLPCPNQPGDHVMPPVPGSSAPNSPMAMLTLNSNCEKEGF
YKFEEQNRAESECPGMNTHSRASCMQMDDVIDDIISLESSYNEEILGLMDPALQMANTLP
VSGNLIDLYGNQGLPPPGLTISNSCPANLPNIKRELTESEARALAKERQKKDNHNLIERR
RRFNINDRIKELGTLIPKSNDPDMRWNKGTILKASVDYIRKLQREQQRAKELENRQKKLE
HANRHLLLRIQELEMQARAHGLSLIPSTGLCSPDLVNRIIKQEPVLENCSQDLLQHHADL
TCTTTLDLTDGTITFNNNLGTGTEANQAYSVPTKMGSKLEDILMDDTLSPVGVTDPLLSS
VSPGASKTSSRRSSMSMEETEHAC
NT seq 1515 nt   +upstreamnt  +downstreamnt
atggaggcgcttagagttcagatgttcatgccatgctcctttgaaagcttatatctcagt
tccgcggagcatcctggggcctccaagcctccgataagctcctccagtatgacatcacgc
atcttgctacgccagcaactcatgcgtgagcagatgcaggagcaggagcgcagggagcag
cagcagaagctgcaggcggcccaattcatgcaacagagagtgcccgtgagtcagacacca
gccataaacgtcagtgtgcccaccacccttccctctgccacccaggtgccgatggaagtc
cttaaggtgcagacccacctcgaaaaccccaccaagtaccacatacagcaagcccaacgg
cagcaggtaaagcagtacctttctaccactttagcaaataaacatgccaaccaagtcctg
agcttgccatgtccaaaccagcctggcgatcatgtcatgccaccggtgccggggagcagc
gcacccaacagccccatggctatgcttacgcttaactccaactgtgaaaaagagggattt
tataagtttgaagagcaaaacagggcggagagcgagtgcccaggcatgaacacacattca
cgagcgtcctgtatgcagatggatgatgtaatcgatgacatcattagcctagaatcaagt
tataatgaggaaatcttgggcttgatggatcctgctttgcaaatggcgaatacgttgcct
gtctcgggaaacttgattgatctttatggaaaccaaggtctgcccccaccaggcctcacc
atcagcaactcctgtccagccaacctccccaacataaaaagggagctcacagagtctgaa
gcaagagcactggccaaagagaggcagaaaaaggacaatcacaacctgattgaacgaaga
agaagatttaacataaatgaccgcattaaggaactaggtactttgattcccaagtcaaat
gatccagacatgcgctggaacaagggaaccatcttaaaagcgtctgtggactatatccga
aagttgcaacgagaacagcaacgcgccaaagaacttgaaaaccgacagaagaaactggag
cacgccaaccggcatttgttgctcagaatacaggaacttgaaatgcaggctcgagctcat
ggactttcccttattccatccacgggtctctgctctccagatttggtgaatcggatcatc
aagcaagaacccgttcttgagaactgcagccaagacctccttcagcatcacgcagaccta
acttgtacaacaactctcgatctcacggatggcaccatcaccttcaacaacaacctcgga
actgggaccgaggccaaccaagcctatagtgtccccacaaaaatgggatccaaactggaa
gacatcctgatggatgacactctttctcccgttggtgtcactgatccactcctttcctca
gtgtcccccggagcctccaaaacaagcagccggaggagcagtatgagcatggaagagacg
gagcatgcttgttag

DBGET integrated database retrieval system