KEGG   Macaca mulatta (rhesus monkey): 695607
Entry
695607            CDS       T01028                                 

Gene name
IKBKE
Definition
(RefSeq) inhibitor of nuclear factor kappa-B kinase subunit epsilon
  KO
K07211  inhibitor of nuclear factor kappa-B kinase subunit epsilon [EC:2.7.11.10]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04620  Toll-like receptor signaling pathway
mcc04621  NOD-like receptor signaling pathway
mcc04622  RIG-I-like receptor signaling pathway
mcc04623  Cytosolic DNA-sensing pathway
mcc04625  C-type lectin receptor signaling pathway
mcc04657  IL-17 signaling pathway
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05162  Measles
mcc05164  Influenza A
mcc05165  Human papillomavirus infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    695607 (IKBKE)
   04621 NOD-like receptor signaling pathway
    695607 (IKBKE)
   04622 RIG-I-like receptor signaling pathway
    695607 (IKBKE)
   04623 Cytosolic DNA-sensing pathway
    695607 (IKBKE)
   04625 C-type lectin receptor signaling pathway
    695607 (IKBKE)
   04657 IL-17 signaling pathway
    695607 (IKBKE)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    695607 (IKBKE)
   05160 Hepatitis C
    695607 (IKBKE)
   05171 Coronavirus disease - COVID-19
    695607 (IKBKE)
   05164 Influenza A
    695607 (IKBKE)
   05162 Measles
    695607 (IKBKE)
   05168 Herpes simplex virus 1 infection
    695607 (IKBKE)
   05167 Kaposi sarcoma-associated herpesvirus infection
    695607 (IKBKE)
   05169 Epstein-Barr virus infection
    695607 (IKBKE)
   05165 Human papillomavirus infection
    695607 (IKBKE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    695607 (IKBKE)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     695607 (IKBKE)
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   695607 (IKBKE)
SSDB
Motif
Pfam: TBK1_CCD1 Pkinase TBK1_ULD PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like APH zf-RING_9
Other DBs
NCBI-GeneID: 695607
NCBI-ProteinID: XP_014973524
Ensembl: ENSMMUG00000002526
UniProt: G7MER5
LinkDB
Position
1
AA seq 716 aa
MQSTANYLWHTDDLLGQGATASVYKARNKKSGELVAVKVFNTTSYLRPREVQVREFEVLR
KLNHQNIIKLFAVEETGGSRQKVLVMEYCSSGSLLSVLESPENAFGLPEDEFLVVLRCVV
AGMNHLRENGIVHRDIKPGNIMRLVGEEGQSIYKLTDFGAARELDDDEKFVSVYGTEEYL
HPDMYERAVLRKPQQKAFGVTVDLWSIGVTLYHAATGSLPFIPFGGPRRNKEIMYRITTE
KPAGAIAGAQRRENGPLEWSYTLPITCQLSLGLQSQLVPILANILEVEQAKCWGFDQFFA
ETSDILQRVVIHVFSLSQAVLHHVYIHAHNTIAIFQEAVHKQTSVAPRHQEYLFEGHLCV
LEPSISAQHIAHTTASSPLTLFSTAIPKGLAFRDPALDVPKFVPKVDLQADYNTAKGVLG
AGYQALRLARVLLDGQELMLRGLHWVMEVLQATCRRTLEVARTSLLYLSSSLGTERSSSV
AGMPEIQELKVAAELRSRLRTLAEVLSRCSQNITETQESLSSLSQELVKSRDQVHEDRSI
QQIQCCLDKMNFIYKQFKKSRMRPGLGYNEEQIHKLDKMNFSHLAKRLLQVFQEECVQKY
QASLVTHGKRMRVVHETRNHLRLVSCSVAACNTEAQGVQESLSKILEELSHQLLQDRAKG
AQASPPPIAPYPSPTPKDLLLHMQELCEGMKLLASDLLDNNRIIERLNRVPAAPDV
NT seq 2151 nt   +upstreamnt  +downstreamnt
atgcagagcacagccaattacctgtggcacacagatgacctgctggggcagggggccact
gccagtgtgtacaaggcccgcaacaagaaatccggggagctggttgctgtgaaggtcttc
aacaccaccagctacctgcggccccgtgaggtgcaggtgagggagtttgaggtcctgcgg
aagctgaaccaccagaacatcatcaagctctttgcggtggaggagacggggggcagccgg
cagaaggtactggtgatggagtactgctccagtgggagcctgctgagcgtgctggagagc
cccgagaacgcctttgggctgccagaggatgagttcctggtggtgctgcgctgtgtggtg
gccggcatgaaccacctgcgggagaacggcatcgtgcatcgcgacatcaagcccgggaac
atcatgcgcctcgtgggggaggaggggcagagcatctacaagctgacggacttcggggct
gcccgggagctggatgatgacgagaagtttgtctcagtctacgggactgaggagtacctg
caccccgacatgtatgagcgggcggtgcttcgaaagccccagcaaaaagcgttcggggtg
actgtggatctctggagcattggagtgaccttgtaccatgcagccaccggcagcctgccc
ttcatcccctttggtgggccacggcggaacaaggagatcatgtaccggatcaccacggag
aagccagctggggccattgcaggtgcccagaggcgggagaatgggcccctggagtggagc
tacaccctccccatcacctgccagctgtcactggggctgcagagccagctggtgcccatc
ctggccaacatcctggaggtggagcaggccaagtgctggggcttcgaccagttctttgcg
gagaccagtgacatcctgcagcgagttgtcatccatgtcttctccctgtcccaggcagtc
ctgcaccacgtctacatccatgcccacaacacgatagccattttccaggaggccgtgcat
aagcagaccagtgtggccccccgacaccaggagtacctctttgagggtcacctctgtgtc
cttgagcccagcatctcagcacagcacatcgcccacacgacagcaagcagccccctgacc
ctcttcagcacagccatccccaaggggctggccttcagggaccctgctctggacgtcccc
aagttcgtccccaaagtggacctgcaggcggattacaacacggccaagggtgtgttgggc
gctggctaccaggccctgcggctggcgcgggtcctgctggacgggcaggagctaatgtta
cgggggctgcactgggtcatggaggtgctccaggccacatgcagacggactctggaggtg
gcgaggacatccctcctctacctcagcagcagcctggggaccgagaggtccagcagcgtg
gctggaatgcctgagatccaggaactgaaggtggccgcagaactgaggtccaggctgcgg
actctagctgaggtcctctccagatgctcccaaaatatcacggagacccaggagagcctg
agcagtctgagccaggagctggtgaagagccgggatcaggtacatgaggacagaagcatc
cagcagattcagtgctgtttggacaagatgaacttcatctacaaacagttcaagaagtct
aggatgaggccagggcttggctacaatgaggaacagattcacaagctggataagatgaat
ttcagccatttagccaaaaggctcctgcaggtgttccaggaggagtgcgtgcagaagtat
caagcatccctagtcacgcacggcaagaggatgagggtggtgcacgagaccaggaaccac
ctgcgcctggtcagctgttctgtggccgcctgtaacacagaagcccagggggtccaggag
agtctcagcaagatcctggaagagctatctcaccagctccttcaggaccgagcaaagggg
gctcaggcctccccgcctcccatagctccttaccccagccctacaccaaaggacctgctt
ctccacatgcaagagctctgcgaggggatgaagctgctggcgtctgacctcctggataac
aaccgcatcattgaacggctaaatagagtcccagcagctcctgatgtctga

DBGET integrated database retrieval system