KEGG   Macaca mulatta (rhesus monkey): 695652
Entry
695652            CDS       T01028                                 

Gene name
CYLD
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase CYLD isoform X1
  KO
K08601  ubiquitin carboxyl-terminal hydrolase CYLD [EC:3.4.19.12]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04064  NF-kappa B signaling pathway
mcc04217  Necroptosis
mcc04380  Osteoclast differentiation
mcc04622  RIG-I-like receptor signaling pathway
mcc04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    695652 (CYLD)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    695652 (CYLD)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    695652 (CYLD)
   04625 C-type lectin receptor signaling pathway
    695652 (CYLD)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    695652 (CYLD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mcc01002]
    695652 (CYLD)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mcc04121]
    695652 (CYLD)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     695652 (CYLD)
Peptidases and inhibitors [BR:mcc01002]
 Cysteine peptidases
  Family C67
   695652 (CYLD)
Ubiquitin system [BR:mcc04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    695652 (CYLD)
SSDB
Motif
Pfam: CYLD_phos_site CAP_GLY UCH COX_ARM
Other DBs
NCBI-GeneID: 695652
NCBI-ProteinID: XP_014981594
Ensembl: ENSMMUG00000012209
UniProt: F6VMX6
LinkDB
Position
20
AA seq 956 aa
MSSGLWSQEKVTSPYWEERIFYLLLQECSVTDKQTQKLLKVPKGSIGQYIQDRSVGHSRI
PSAKGKKNQIGLKILEQPHAVLFVDEKDVAEINEKFTELLLAITNCEERFSLFKNRNRLS
KGLQIDVGCPVKVQLRSGEEKFPGVVRFRGPLLAERTVSGIFFGVELLEEGRGQGFTDGV
YQGKQLFQCDEDCGVFVALDKLELIEDDDTALESDYAGPVDTMQVELPPLEINSRVSLKV
GETIESGTVIFCDVLPGKESLGYFVGVDMDNPIGNWDGRFDGVQLCSFACVESTILLHIN
DIIPALSESVSQERRPPKLAFMSRGVGDKGSSSHNKPKATGSTSDPGNRNRSELFYTLNG
SSVDSQPQSKSKNTWYIDEVAEDPAKSLTEISTDFDRSSPPLQPPPVNSLSTENRFHSLP
FSLTKMPNTNGSIGHSPLSLSAQSVMEELNTAPVQESPPLAMPPGNSHGLEVGSLAEVKE
NPPFYGVIRWIGQPPGLNEVLAGLELEDECAGCTDGTFRGTRYFTCALKKALFVKLKSCR
PDSRFASLQPVSNQIERCNSLAFGGYLSEVVEENTPPKMEKEGLEIMIGKKKGIQGHYNS
CYLDSTLFCLFAFSSVLDTVLLRPKEKNDVEYYSETQELLRTEIVNPLRIYGYVCATKIM
KLRKILEKVEAASGFTSEEKDPEEFLNILFHHILRVEPLLKIRSAGQKVQDCYFYQIFME
KNEKVGVPTIQQLLEWSFINSNLKFAEAPSCLIIQMPRFGKDFKLFKKIFPSLELNITDL
LEDTPRQCRICGGLAMYECRECYDDPDISAGKIKQFCKTCNTQVHLHPKRLNHKYNPVSL
PKDLPDWDWRHGCIPCQKMELFAVLCIETSHYVAFVKYGKDDSAWLFFDSMADRDGGQNG
FNIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLYK
NT seq 2871 nt   +upstreamnt  +downstreamnt
atgagttcaggcttatggagccaagaaaaagttacttcgccctactgggaagagcggatt
ttttatttgcttcttcaagaatgcagcgttacagacaaacaaacacaaaagctccttaaa
gtaccgaagggaagtataggacagtatattcaagatcgttctgtggggcattcaaggatt
ccttctgcaaaaggcaagaaaaatcagattggattaaaaattctagagcaacctcatgca
gttctctttgttgatgaaaaggatgttgcagagataaatgaaaagttcacagagttactt
ttggcaattaccaattgtgaggagaggttcagcctgtttaaaaacagaaacagactaagt
aaaggcctccaaatagacgtgggctgccctgtgaaagtacagttgagatctggggaagaa
aaatttcctggagttgtgcgcttcagaggaccactgttagcagagaggacagtctccgga
atattctttggagttgaattgctggaagaaggtcgtggccaaggtttcactgacggggtg
taccaagggaaacagctttttcagtgtgatgaagactgtggcgtgtttgttgcattggac
aagctagaactcatagaagatgatgacactgcgttggaaagtgattatgcaggtcctgtg
gacacaatgcaggtcgagcttcctcctttggaaataaactccagagtttctttgaaggtt
ggagaaacaatagaatctggaacagttatattctgtgatgttttgccaggaaaagaaagc
ttaggatattttgttggtgtggacatggataaccctattggcaactgggatggaagattc
gacggagtgcagctttgcagttttgcgtgtgttgaaagtacaattctgttgcacatcaat
gatatcatcccagctttatcagagagcgtgtcacaggaaaggaggcctcccaaacttgcc
tttatgtcaagaggtgttggggacaaaggttcgtccagtcataataaaccaaaggcgaca
ggatctacctcagaccctggaaatagaaacagatctgaattattttataccttaaatggg
tcttctgttgactcacaaccacaatccaaatcaaaaaatacatggtacattgatgaagtt
gcagaagaccctgcaaaatctcttacagagatatctacagactttgaccgttcttcacca
ccactccagcctcctcctgtgaactcactgtccaccgagaacagattccactctttaccg
ttcagtctcacaaagatgcctaataccaatggaagtattggccacagtccactttctctg
tcagcccagtctgtgatggaagagctaaacactgcacccgtgcaagagagtccacccttg
gctatgcctcctgggaactcacatggtctagaagtgggctcactggctgaagttaaggag
aaccctcctttctacggggtaatccgttggatcggtcagcccccaggactgaatgaagta
cttgctggactggaactggaagatgagtgtgcaggctgtacggatggaaccttcagaggc
actcggtatttcacctgtgccctgaagaaggcgctgtttgtgaaactgaagagctgcagg
cctgactctaggtttgcatcattgcagccggtttctaatcagatcgagcgctgtaactcc
ttagcatttggaggctacttaagtgaagtagtagaagaaaatactccgccaaaaatggaa
aaagaaggcttggagataatgattgggaagaagaaaggcattcagggtcattacaattct
tgttacttagactcaaccttattctgcttatttgcttttagttctgttctggacactgtg
ttacttagacccaaagaaaagaatgatgtggaatattatagtgaaacccaagagttactg
aggacagaaattgttaatcctctgagaatatatggatatgtgtgtgccacaaaaattatg
aaactgaggaaaatacttgaaaaggtggaggctgcatcaggatttacctctgaagaaaaa
gatcctgaggaattcttgaatatcctgtttcatcatattttaagggtagaacctttgcta
aaaataagatcagcaggtcaaaaggtacaagattgttacttctatcaaatttttatggaa
aaaaatgagaaagttggagttcccacaattcagcagttgttagaatggtctttcatcaac
agtaacctgaaatttgcagaggcaccatcatgtctgattattcagatgcctcgatttgga
aaagactttaaactatttaaaaaaatttttccttctctggaattaaatataaccgattta
cttgaagacactcccagacagtgccggatatgtggagggcttgcaatgtatgagtgtaga
gaatgctacgatgatccggacatctcagctggaaaaatcaagcagttttgtaaaacctgc
aacactcaagtccaccttcatcccaagaggctgaatcataaatataacccagtgtcactt
cccaaagacttacctgactgggactggagacacggctgcatcccttgccagaagatggag
ttatttgccgttctctgcatagaaacaagccactatgttgcttttgtgaagtatgggaag
gacgactccgcctggctcttctttgacagcatggccgatcgggatggtggtcagaacggc
ttcaacattcctcaagtcaccccatgcccagaagtaggagagtacttgaagatgtctctg
gaagacctgcattccttggactccagaagaatccaaggctgtgcgcgaagactgctttgt
gatgcgtatatgtgcatgtaccagagtccaacaatgagtttgtacaaataa

DBGET integrated database retrieval system