KEGG   Macaca mulatta (rhesus monkey): 695730Help
Entry
695730            CDS       T01028                                 

Gene name
PCSK2
Definition
(RefSeq) proprotein convertase subtilisin/kexin type 2
  KO
K01360  proprotein convertase subtilisin/kexin type 2 [EC:3.4.21.94]
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mcc01002]
    695730 (PCSK2)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mcc03110]
    695730 (PCSK2)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.94  proprotein convertase 2
     695730 (PCSK2)
Peptidases [BR:mcc01002]
 Serine Peptidases
  Family S8: subtilisin family
   695730 (PCSK2)
Chaperones and folding catalysts [BR:mcc03110]
 Intramolecular chaperones
  Subtilisin family
   695730 (PCSK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 P_proprotein S8_pro-domain Peptidase_S8_N
Motif
Other DBs
NCBI-GeneID: 695730
NCBI-ProteinID: NP_001252954
Ensembl: ENSMMUG00000014626
UniProt: F7GNE5
LinkDB All DBs
Position
10
AA seq 638 aa AA seqDB search
MKGGCVSQWKAAAGFLFCVMVFASAERPVFTNHFLVELHKGGEDEARQVAAEHGFGVRKL
PFAEGLYHFYHNGLAKAKRRRSLHHKQQLERDPRVKMALQQEGFDRKKRGYRDINEIDIN
MNDPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLASN
YNAEASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVAGIRM
LDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGK
GSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK
RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLGLTWRDMQHLTVLTSKRN
QLHDEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQDPEKIP
STGKLVLTLTTDACEGKENFVRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRP
RDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGFVGSAPQKGVLKEWTLMLHGTQSAPYI
DQVVRDYQSKLAMSKKEELEEELDEAVERSLKSILSKN
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgaagggtggttgtgtctcccagtggaaggcggccgccgggttcctcttctgtgtcatg
gtttttgcatctgctgagcgaccggtcttcacgaatcattttcttgtggagttgcataaa
gggggagaggacgaagctcgccaagttgcagcagaacacggctttggagtccgaaagctt
ccctttgctgaaggtctgtaccacttttatcacaatggccttgcaaaggccaagagaaga
cgcagcctacaccacaagcagcagctggagagagaccctagggtaaagatggctttacag
caggaaggatttgaccgaaaaaagcgaggttacagagacatcaatgagatcgacatcaac
atgaacgatcctctttttacaaagcaatggtatctgatcaatactggccaagctgatggc
actcctggccttgatttgaatgtggctgaagcctgggagctgggatacacagggaagggt
gttaccattggaattatggatgatgggattgactatctccacccggacctggcctccaac
tataatgccgaagcaagttacgacttcagtagcaacgacccctatccttaccctcggtac
acagacgactggtttaacagccatgggacccgatgtgcaggagaagtttctgctgccgcc
aacaacaatatctgtggggtcggagtagcatacaactccaaggttgcaggcatccggatg
ctggaccagccgttcatgacggacatcatcgaggcctcctccatcagccacatgccgcag
ctgatcgacatctacagcgccagctggggccccacagacaacggcaagacagtggatggg
ccccgggagctcacgctgcaggccatggccgatggcgtgaacaagggccgcggcggcaag
ggcagcatctatgtgtgggcctccggggacggcggcagctatgatgactgcaactgcgac
ggctacgcctccagcatgtggaccatctccatcaactcagccatcaacgacggcaggacc
gccctgtacgacgagagctgctcttccaccctggcttccaccttcagcaacgggaggaaa
aggaaccctgaggccggtgtggcaaccacagatttgtacggcaactgcactctgaggcat
tctgggacatctgcagctgcccctgaggcagctggcgtgtttgcactggctctggaggct
aacctgggtctgacctggcgggacatgcagcatctgactgtgctcacctccaaacggaac
cagcttcacgacgaagttcatcagtggcggcgcaacggggtcggcctggaatttaatcac
ctctttggctacggggtccttgatgcaggcgccatggtgaaaatggctaaagactggaaa
accgtgcccgagagattccactgtgtgggaggctccgtgcaggaccctgagaaaatacca
tccactggcaagttggtgctgacactcacaaccgatgcctgtgaggggaaggaaaatttt
gtccgctatctggagcatgtccaggctgtcatcacggtcaacgcgaccaggagaggagac
ctgaacatcaacatgacttcccctatgggcaccaagtccattttgctgagccggcgtccg
agggatgacgactccaaggtgggctttgacaagtggcctttcatgaccacccacacgtgg
ggggaagacgcccgaggcacctggaccctggagctggggtttgtcggcagtgccccgcag
aagggggtgctgaaggagtggaccctgatgctgcatggcactcagagcgccccgtacatc
gaccaggtggtgcgggattaccagtccaagctggccatgtccaagaaagaggagctggag
gaagagctggacgaagccgtggagagaagcctgaaaagcatccttagcaagaactag

DBGET integrated database retrieval system