KEGG   Macaca mulatta (rhesus monkey): 695852
Entry
695852            CDS       T01028                                 

Gene name
RALB
Definition
(RefSeq) ras-related protein Ral-B
  KO
K07835  Ras-related protein Ral-B
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc05200  Pathways in cancer
mcc05210  Colorectal cancer
mcc05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    695852 (RALB)
   04015 Rap1 signaling pathway
    695852 (RALB)
   04072 Phospholipase D signaling pathway
    695852 (RALB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    695852 (RALB)
  09162 Cancer: specific types
   05210 Colorectal cancer
    695852 (RALB)
   05212 Pancreatic cancer
    695852 (RALB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    695852 (RALB)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mcc04031]
    695852 (RALB)
Membrane trafficking [BR:mcc04131]
 Exocytosis
  Tethering complex
   Exocyst complex assembly proteins
    695852 (RALB)
GTP-binding proteins [BR:mcc04031]
 Small (monomeric) G-proteins
  Ras Family
   Ral
    695852 (RALB)
SSDB
Motif
Pfam: Ras Roc Arf RsgA_GTPase SRPRB GTP_EFTU MMR_HSR1 Gtr1_RagA AAA_25 FeoB_N AAA_24 Ser_hydrolase
Other DBs
NCBI-GeneID: 695852
NCBI-ProteinID: NP_001244728
Ensembl: ENSMMUG00000046774
UniProt: A0A1D5R129
LinkDB
Position
12
AA seq 206 aa
MAANKSKGQSSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGE
EVQIDILDTAGQEDYAAIRDNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKAEEDK
IPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYVETSAKTRANVDKVFFDLMREIRTKK
MSENKDKNGKKSGKNKKSFKERCCLL
NT seq 621 nt   +upstreamnt  +downstreamnt
atggctgccaacaagagtaagggccagagctccttggccctccacaaggtgatcatggtt
ggcagtggaggcgttggcaagtcggccctgacgcttcagttcatgtatgacgagtttgta
gaagactatgaacctaccaaagctgacagttatagaaagaaagtggttcttgatggggaa
gaagttcagatagatattctggacaccgctgggcaagaggactacgcagccattcgagat
aactactttcggagtggggaagggtttcttcttgtgttctcaatcacagaacatgaatcc
ttcacagcaactgccgaattcagggaacagattctccgtgtgaaggctgaagaagataaa
attccattgcttgtcgtgggaaacaagtctgacttagaggagcggaggcaggtgcctgtg
gaggaggccaggagtaaagccgaagagtggggcgtgcagtatgtggagacgtcggcgaag
acgcgggccaacgtggacaaggtgttctttgacctaatgagagaaatcagaacaaagaag
atgtccgaaaacaaagacaagaatggcaagaaaagcggcaagaacaagaaaagttttaaa
gaaagatgttgcttactatga

KEGG   Macaca mulatta (rhesus monkey): 703440
Entry
703440            CDS       T01028                                 

Gene name
RALA
Definition
(RefSeq) ras-related protein Ral-A
  KO
K07834  Ras-related protein Ral-A
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc05132  Salmonella infection
mcc05200  Pathways in cancer
mcc05210  Colorectal cancer
mcc05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    703440 (RALA)
   04015 Rap1 signaling pathway
    703440 (RALA)
   04072 Phospholipase D signaling pathway
    703440 (RALA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    703440 (RALA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    703440 (RALA)
   05212 Pancreatic cancer
    703440 (RALA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    703440 (RALA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    703440 (RALA)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mcc04031]
    703440 (RALA)
Membrane trafficking [BR:mcc04131]
 Exocytosis
  Tethering complex
   Exocyst complex assembly proteins
    703440 (RALA)
GTP-binding proteins [BR:mcc04031]
 Small (monomeric) G-proteins
  Ras Family
   Ral
    703440 (RALA)
SSDB
Motif
Pfam: Ras Roc Arf RsgA_GTPase GTP_EFTU MMR_HSR1 AAA_25 MMR_HSR1_Xtn ThiF
Other DBs
NCBI-GeneID: 703440
NCBI-ProteinID: NP_001253385
Ensembl: ENSMMUG00000042241
UniProt: F7GPM1
LinkDB
Position
3
AA seq 206 aa
MAANKPKGQNSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGE
EVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENV
PFLLVGNKSDLEDKRQVSVEEAKNRAEQWNVNYVETSAKTRANVDKVFFDLMREIRARKM
EDSKEKNGKKKRKSLAKRIRERCCIL
NT seq 621 nt   +upstreamnt  +downstreamnt
atggccgcaaataagcccaagggtcagaattctttggccttacacaaagtcatcatggtg
ggcagtggtggcgtgggcaagtcagctctgactctacagttcatgtacgatgagtttgtg
gaggactatgagcctaccaaagcggacagctatcggaagaaggtagtgctagatggggag
gaagtacagatcgatatcttagatacagctgggcaggaggactacgctgcaattagagac
aactacttccgaagcggggaggggttcctctgtgttttctctattacagaaatggaatcc
tttgcagctacagctgacttcagggagcagattttaagagtaaaagaagatgagaatgtt
ccctttctactggttggtaacaaatcagatttagaagataaaaggcaggtttctgtagaa
gaggcaaaaaacagagctgagcagtggaatgttaactacgtggaaacatctgctaaaaca
cgagctaatgttgacaaggtattttttgatttaatgagagaaattcgagcgagaaagatg
gaagacagcaaagaaaagaatggaaaaaagaagaggaaaagtttagccaagagaatcaga
gaaagatgctgcattttataa

DBGET integrated database retrieval system