KEGG   Macaca mulatta (rhesus monkey): 696056
Entry
696056            CDS       T01028                                 

Gene name
CHPT1
Definition
(RefSeq) cholinephosphotransferase 1 isoform X1
  KO
K00994  diacylglycerol cholinephosphotransferase [EC:2.7.8.2]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00440  Phosphonate and phosphinate metabolism
mcc00564  Glycerophospholipid metabolism
mcc00565  Ether lipid metabolism
mcc01100  Metabolic pathways
mcc05231  Choline metabolism in cancer
Module
mcc_M00090  Phosphatidylcholine (PC) biosynthesis, choline => PC
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    696056 (CHPT1)
   00565 Ether lipid metabolism
    696056 (CHPT1)
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    696056 (CHPT1)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    696056 (CHPT1)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.2  diacylglycerol cholinephosphotransferase
     696056 (CHPT1)
SSDB
Motif
Pfam: CDP-OH_P_transf
Other DBs
NCBI-GeneID: 696056
NCBI-ProteinID: XP_028685640
Ensembl: ENSMMUG00000020877
LinkDB
Position
11
AA seq 406 aa
MAAGAGARPAPRWLRALSEPLSAAQLRRLEEHRYSAAGVSLLEPPLQLYWTWLLQWIPLW
MAPNSITLLGLAVNVVTTLVLISYCPTATEEAPYWTYLLCALGLFIYQSLDAIDGKQARR
TNSCSPLGELFDHGCDSLSTVFMAVGASIAARLGTHPDWLFVCSFIGMFVFYCAHWQTYV
SGVLRFGKVDVTEIQIALVIVFVLSAFGGATMWDYTIPILEIKLKILPVLGFLGGVIFSC
SNYFHVILHGGVGKNGSTIAGTSVLSPGLHIGLIIILAIMIYKKSATNVFEKHPCLYTLM
FGCVFAKVSQKLVIAHMTKSELYLQDTVFLGPGLLFLDQYFNNFIDEYVVLWIAMVISSF
DMVIYFSALCLQISRHLHLNIFKTTCHQAPEQVQVLSSKSHQNNMD
NT seq 1221 nt   +upstreamnt  +downstreamnt
atggcggcaggcgccggggccaggcccgcgccgcgctggctgagggcgctaagcgagccg
ctgagcgcggcgcagctgcggcgactggaggagcaccgctacagcgcggcgggtgtctcg
ctgctcgagccgccgctgcagctctactggacctggctgctgcagtggatcccactctgg
atggcccctaactccatcaccctgctcgggctcgccgtcaacgtggtcaccacgctcgtg
ctcatctcctactgtcccacggccaccgaggaggcaccatactggacataccttttatgt
gcactgggactttttatctaccagtcactggatgccattgatgggaaacaagccagaaga
acaaactcttgttctcctttaggggagctctttgaccatggttgtgactctctttccaca
gtatttatggcagtgggagcttcaattgccgctcgcttaggaactcatcctgactggttg
tttgtctgctcttttattgggatgtttgtgttttattgcgctcattggcagacctatgtt
tcaggcgtgttgagatttggaaaagtggatgtaactgaaattcagatagctttagtgatt
gtctttgtattgtctgcatttggaggagcaacaatgtgggactatacgattcccattcta
gaaataaaattgaagatccttccagttcttggatttctaggtggagtaatattttcctgt
tcaaattatttccatgttatcctccatggtggtgttggcaagaatggatctactatagca
ggcaccagtgtcttgtcacctggactccacataggactaattattatactggcaataatg
atctataaaaagtcagcaactaatgtgtttgaaaagcatccttgtctttataccctaatg
tttggatgtgtctttgctaaagtctcacaaaaattagtgatagctcacatgaccaaaagt
gaactgtatcttcaagacactgtctttttggggccaggtcttttatttttagaccagtac
tttaataattttatagacgaatatgttgttctatggatagcaatggtgatttcttcattt
gatatggtgatatactttagtgctttgtgcctgcaaatttcaagacaccttcatctaaat
atattcaagactacatgtcatcaagcacctgaacaggttcaagttctttcttcaaaaagt
catcagaataacatggattga

DBGET integrated database retrieval system