KEGG   Macaca mulatta (rhesus monkey): 696298
Entry
696298            CDS       T01028                                 

Gene name
TLN1
Definition
(RefSeq) talin-1 isoform X1
  KO
K06271  talin
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04015  Rap1 signaling pathway
mcc04510  Focal adhesion
mcc04611  Platelet activation
mcc05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    696298 (TLN1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    696298 (TLN1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    696298 (TLN1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    696298 (TLN1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    696298 (TLN1)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   696298 (TLN1)
  Exosomal proteins of other cancer cells
   696298 (TLN1)
SSDB
Motif
Pfam: I_LWEQ VBS Talin_middle FERM_f0 FERM_M FERM_N ACBP IRS DUF1013 RA DUF3025
Other DBs
NCBI-GeneID: 696298
NCBI-ProteinID: XP_014972948
Ensembl: ENSMMUG00000031856
LinkDB
Position
15
AA seq 2559 aa
MVALSLKISIGNVVKTMQFEPSTMVYDACRIIRERIPEAPAGPPSDFGLFLSDDDPKKGI
WLEAGKALDYYMLRNGDTMEYRKKQRPLKIRMLDGTVKTIMVDDSKTVTDMLMTICARIG
ITNHDEYSLVRELMEEKKEEVTGTLRKDKTLLRDEKKMEKLKQKLHTDDELNWLDHGRTL
REQGVEEHETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAG
FQCQIQFGPHNEQKHKAGFLDLKDFLPKEYVKQKGERKIFQAHKNCGQMSEIEAKVRYVK
LARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWNLTNIKRWA
ASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILKKKKSKDHFGLEGDEESTML
EDSVSPKKSTVLQQQYNRVGKVEHGSVALPAIMRSGASGPENFQVGSMPPAQQQITSGQM
HRGHMPPLTSAQQALTGTINSSMQAVQAAQATLDDFDTLPPLGQDAASKAWRKNKMDESK
HEIHSQVDAITAGTASVVNLTAGDPAETDYTAVGCAVTTISSNLTEMSRGVKLLAALLED
EGGSGRPLLQAAKGLAGAVSELLRSAQPASAEPRQNLLQAAGNVGQASGELLQQIGESDT
DPHFQICASGGAGVRSPPDSPTDVLMQLAKAVASAAAALVLKAKSVAQRTEDSGLQTQVI
AAATQCALSTSQLVACTKVVAPTISSPVCQEQLVEAGRLVAKAVEGCVSASQAATEDGQL
LRGVGAAATAVTQALNELLQHVKAHATGAGPAGRYDQATDTILTVTENIFSSMGDAGEMV
RQARILAQATSDLVNAIKADAEGESDLENSRKLLSAAKILADATAKMVEAAKGAAAYPDS
EEQQQRLREAAEGLRMATNAAAQNAIKKKLVQRLEHAAKQAAASATQTIAAAQHAASTPK
ASAGPQPLLVQSCKAVAEQIPLLVQGVRGSQAQPDSPSTQLALIAASQSFLQPGGKMVAA
AKASVPTIQDQASAMQLSQCAKNLGTALAELRTAAQKAQEACGPLEMDSALSLVQNLEKD
LQEVKAAARDGKLKPLPGETMEKCAQDLGNSTKAVSSAIAQLLGEVAQGNENYAGIAARD
VAGGLRSLAQAARGVAALTSDPAVQAIVLDTASDVLDKASSLIEEAKKAAGHPGDPESQQ
RLAQVAKAVTQALNRCVSCLPGQRDVDNALRAVGDASKRLLSDSLPPSTGTFQEAQSRLN
EAAAGLNQAATELVQASRGTPQDLARASGRFGQDFSTFLEAGVEMAGQAPSQEDRAQVVS
NLKGISMSSSKLLLAAKALSTDPAAPNLKSQLAAAARAVTDSINQLITMCTQQAPGQKEC
DNALRELETVRELLENPVQPINDMSYFGCLDSVMENSKVLGEAMTGISQNAKNGNLPEFG
EAISTASKALCGFTEAAAQAAYLVGVSDPNSQAGQQGLVEPTQFARANQAIQMACHSLGE
PGCTQAQVLSAATIVAKHTSALCNSCRLASARTANPTAKRQFVQSAKEVANSTANLVKTI
KALDGAFTEENRAQCRAATAPLLEAVDNLSAFASNPEFSSIPAQISPEGRAAMEPIVISA
KTMLESAGGLIQTARALAVNPRDPPSWSVLAGHSRTVSDSIKKLITSMRDKAPGQLECEA
AIAGLNSCLRDLDQASLAAVSQQLAPREGISQEALHTQMLTAVQEISHLIEPLANAARAE
ASQLGHKVSQMAQYFEPLTLAAVGAASKTLSHPQQMALLDQTKTLAESALQLLYTAKEAG
GNPKQAAHTQEALEEAVQMMTEAVEDLTTTLNEAASAAGVVGGMVDSITQAINQLDEGPM
GEPEGSFVDYQTTMVRTAKAIAVTVQEMVTKSNSSPEELGPLANQLTSDYGRLASEAKPA
AVAAENEEIGSHIKHRVQELGHGCAALVTKAGALQCSPSDAYTKKELIECARRVSEKVSH
VLAALQAGNRGTQACITAASAVSGIIADLDTTIMFATAGTLNREGTETFADHREGILKTA
KVLVEDTKVLVQNAAGSQEKLAQAAQSSVATITRLTDVVKLGAASLGAEDPETQVVLINA
VKDVAKALGDLISATKAAAGKVGDDPAVWQLKNSAKVMVTNVTSLLKTVKAVEDEATKGT
RALEATTEHIRQELAVFCSPEPPAKTSTPEDFIRMTKGITMATAKAVAAGNSCRQEDVIA
TANLSRRAIADMLRACKEAAYHPEVAPDVRLRALHYGRECANGYLELLDHVLLPTLQKPS
PELKQQLTGHSKRVAGSVTELIQAAEAMKGTEWVDPEDPTVIAENELLGAAAAIEAAAKK
LEQLKPRAKPKEADESLNFEEQILEAAKSIAAATSALVKAASAAQRELVAQGKVGAIPAN
ALDDGQWSQGLISAARMVAAATNNLCEAANAAVQGHASQEKLISSAKQVAASTAQLLVAC
KVKADQDSEAMKRLQAAGNAVKRASDNLVKAAQKAAAFEEQENETVVVKEKMVGGIAQII
AAQEEMLRKERELEEARKKLAQIRQQQYKFLPSELRDEH
NT seq 7680 nt   +upstreamnt  +downstreamnt
atggttgcactttcgctgaagatcagcattgggaatgtggtgaagacgatgcagtttgag
ccgtctaccatggtgtacgacgcctgccgcatcattcgtgagcggatcccagaggccccg
gctggtcctcccagcgactttgggctctttctgtcagatgatgaccccaaaaagggtata
tggctggaggctgggaaagctttggactactacatgctccgaaatggggacactatggag
tacaggaagaaacagagacccctgaagatccgtatgctggatggaactgtgaagacgatc
atggtggatgactctaagactgtcactgacatgctcatgaccatctgtgcccgcattggc
atcaccaaccatgatgaatattcattggttcgagagctgatggaagagaaaaaggaggaa
gtgacagggaccttaagaaaagacaagacattgctgcgagatgaaaagaagatggagaaa
ttaaagcagaaattacacacagatgacgagttgaactggctggaccatggccggacactg
agggagcagggtgtagaggagcatgagacgctgctgctgcggaggaagttcttttactca
gaccagaatgtggattcccgggaccccgtacagctgaacctcctgtatgtgcaggcacga
gatgacatcctgaatggctcccaccctgtctcctttgacaaggcctgtgagtttgctggc
ttccaatgccagatccagtttgggccccacaatgagcagaaacacaaggctggcttcctc
gacctgaaggacttcctgcccaaggagtatgtgaagcagaagggagagcgtaagatcttc
caggcacacaagaattgtgggcagatgagtgagattgaggccaaggtccgctacgtgaag
ctagcccgttctctcaagacttacggtgtctccttcttcctggtgaaggaaaaaatgaaa
gggaagaacaagctagtgcccaggcttctgggcatcaccaaggagtgtgtgatgcgagtg
gatgagaaaaccaaggaagtgatccaggagtggaacctcaccaacatcaaacgctgggct
gcctctcccaaaagcttcaccctggattttggagattaccaagatggctactactcagta
cagacaactgaaggggagcagattgcacagctcattgctggctacattgatatcatcctg
aagaagaaaaaaagcaaggatcactttgggctggaaggagatgaggagtctactatgctg
gaggactcagtgtcccccaaaaagtcaacagtcctgcagcagcagtacaaccgggtaggg
aaagtggagcatggctctgtggccctgcctgccatcatgcgctctggagcctctggtcct
gagaatttccaggtgggcagcatgccccctgcccagcagcagattaccagcggccagatg
caccgaggacacatgcctcctctgacttcggcccagcaggcactcactggaaccattaac
tccagcatgcaggccgtgcaggctgcccaggccaccctggatgactttgacactctgcca
cctcttggccaggatgctgcctctaaggcctggcgtaagaacaagatggatgaatcaaag
catgagatccactctcaggtagatgccatcacagctggtactgcgtctgtggtgaacctg
acagcaggggaccctgctgagacagactataccgcagtgggctgtgcagtcaccacaatc
tcctccaacctgacggagatgtcccgtggggtgaagctgctggctgccttgctggaggac
gaaggcggcagtggccggccgctgttgcaggcagcaaagggccttgcgggggcagtgtca
gaactgctgcgcagtgcgcaaccagccagtgctgagccccgtcagaacctgctgcaagca
gctgggaacgtgggccaggccagtggggagctgttgcaacaaattggggaaagtgatact
gacccccacttccagatatgtgcatccggaggggctggggttcgatctccccccgattcc
cctacggatgtgctaatgcagctcgccaaagctgtggcaagtgctgcagctgccctggtc
ctcaaggccaagagtgtggcccagcggacagaggactcaggacttcagacccaagttatt
gctgcagcaacacagtgtgccctgtctacttcccaactagtggcctgtactaaggtggtg
gcacctacaatcagctcacctgtctgccaagaacaactggtggaggctggacgactggta
gccaaagccgtggagggctgtgtgtctgcttcccaggcagctacagaggatgggcaactg
ttgcgaggggtaggagcagcagccacagctgtcacccaggccctgaatgagctgctgcag
catgtgaaggcccatgccacaggggctgggcctgctggccgttatgaccaggccactgac
accatccttactgtcactgagaacatctttagctccatgggtgatgctggggagatggtg
cgacaggcccgcatcctggcccaagccacatctgacttggtcaatgccatcaaggctgat
gctgagggggaaagtgatctggagaactcccgcaagctcttaagtgctgccaagatccta
gctgatgccacagccaagatggtagaggctgccaagggagcagccgcctaccctgacagt
gaggagcagcagcagcggctgcgggaggcagctgaggggctgcgcatggccaccaatgca
gccgcgcagaatgccatcaagaaaaagctggtgcagcgcctggagcatgcagccaagcag
gctgcagcctcagccacacagaccatcgctgcagctcagcatgcagcctctacccccaag
gcctctgccggcccccagcccctgctggtgcagagctgcaaggcagtggcagagcagatt
ccgctgctggtgcagggcgtccgaggaagccaagcccagcctgacagccccagcactcag
cttgccctcattgctgccagccagagcttcctgcagccaggtgggaagatggtggcagct
gcaaaggcctcagtgccaacgattcaggaccaggcttcagccatgcagctgagtcagtgt
gccaagaacctgggcaccgcgctggctgaactccggacagctgcccagaaggctcaggaa
gcatgtggacctttggagatggattctgccctgagtttggtacagaatctagagaaagat
ctacaggaagtgaaggcagcggctcgagatggcaagcttaaacccttacctggggagaca
atggagaagtgtgcccaggacctgggcaacagcaccaaagccgtgagctccgccatcgcc
cagctactgggagaggttgcccagggcaatgagaattatgcaggtattgcagctcgggat
gtggcaggtgggcttcggtcactggcccaggccgctaggggagttgctgcactgacgtca
gatcctgcagtgcaggccattgtacttgacacggccagtgatgtgctggacaaagctagc
agccttattgaggaggcgaaaaaggcagctggccatccaggggaccctgagagccagcag
cggcttgcccaggtggctaaagcagtgacccaggctctgaaccgctgtgtcagctgccta
cctggccagcgcgatgtggataatgccctgagggcagttggagatgccagcaagcgactc
ctgagtgactcgcttcctcctagcactgggacatttcaagaagctcagagccggttgaat
gaagcggctgctgggctgaatcaggcagccacagaactggtgcaggcctctcggggaacc
cctcaggacctggctcgagcctcaggccgatttggacaggacttcagcaccttcctggaa
gcgggtgtggagatggcaggccaggctccgagccaggaggaccgagcccaagttgtgtcc
aacttgaagggcatctccatgtcttcaagcaaacttcttctggctgccaaggccctgtcc
acggaccctgctgcccctaacctcaagagtcagctggctgcagctgccagggcagtaact
gacagtatcaatcagctcatcactatgtgcacccagcaggcacccggccagaaggagtgt
gataatgccctgcgggaattggagacagtccgggaactcctggagaacccagtccagccc
atcaatgacatgtcctactttggttgcctggacagtgtaatggagaactcaaaggtgctg
ggcgaggctatgactggcatctcccaaaatgccaagaatggaaatctgccagagtttgga
gaggccatttccacagcctcaaaggcactttgtggcttcacagaggcagctgcacaggct
gcatatctggttggtgtctctgaccccaatagtcaagctggacagcaagggctggtggag
cccacacagtttgcccgtgcaaaccaggcaattcagatggcctgccacagtttgggagag
cctggctgtacccaggcccaggtgctctccgcagccaccattgtggccaaacacacctct
gcactgtgtaacagctgtcgcctggcttctgcccgtaccgccaatcctactgccaagcgc
cagtttgtacagtcagccaaggaggtggccaacagcacagctaatcttgtcaagaccatc
aaggcgctagatggggccttcacagaggagaaccgtgcccagtgccgagcagcaacagcc
cctctgctggaggctgtggacaatctgagtgcctttgcgtccaaccctgagttctccagc
attcctgcccagatcagccctgagggtcgggctgccatggagcccattgtgatatctgcc
aagacaatgttagagagtgctgggggactcatccagacagcccgggccctcgcagtcaat
ccccgggaccccccgagctggtcagtgctggccggccactcccgtactgtctcagactcc
atcaagaagctaattacaagcatgagggacaaggctccagggcagctggagtgtgaagcg
gccattgcaggtctgaacagttgtctacgggacctagaccaggcttccctcgctgcagtc
agccagcagcttgctccccgtgagggaatctctcaagaggccttgcacactcagatgctc
actgcagtacaagagatctcccatctcattgagccactggccaatgctgcccgggctgaa
gcctcccagctgggacacaaggtgtcccagatggcccagtactttgagccgctcaccctg
gctgcagtgggtgctgcctccaagaccctgagccacccgcagcagatggcgctcctggac
cagactaaaacattggcagaatctgccctgcagttgctatacactgccaaggaggctggt
ggtaacccaaagcaagcagctcacacccaggaagccctggaggaggctgtgcagatgatg
acagaggccgtagaggacctgacaacaactctcaacgaggcagccagtgctgccggcgtc
gtgggtggcatggtggactccatcacccaggccatcaaccagctagatgaaggaccaatg
ggtgaaccagaaggttccttcgtggattaccaaacaactatggtgcggacagccaaggcc
attgcagtgaccgttcaggagatggttaccaagtcaaacagcagcccagaggagctgggc
cctcttgctaaccagctgaccagtgactatggccgtctggcctcggaggccaagcctgca
gcggtggctgctgaaaatgaagagataggttcccatatcaaacaccgggtacaggagctg
ggccatggctgtgccgctctggtcaccaaggcaggcgccctgcagtgcagccccagtgat
gcctacaccaagaaggagctcatagaatgtgcccggagagtttctgagaaggtctctcac
gtcctagctgcgctccaggctgggaatcgtggcacccaggcctgcatcacagcggccagc
gctgtgtctggtatcattgctgacctcgacaccaccatcatgttcgccactgctggcacg
ctcaatcgcgagggtactgaaactttcgctgaccaccgggagggcatcctgaagactgcg
aaggtgctggtggaggacaccaaggtcctggtgcaaaacgcagccgggagccaggagaag
ttggcgcaggctgcccagtcctccgtggcgaccatcacccgcctcactgatgtggtcaag
ctgggtgcagccagcctgggagctgaggaccctgagacccaggtggtactaatcaacgca
gtgaaagatgtagccaaggccctgggagacctcatcagtgcaacgaaggctgcagctggc
aaagttggagatgaccctgctgtgtggcagctaaagaactctgccaaggtgatggtgacc
aatgtgacatcattgcttaagacagtaaaagccgtggaagatgaggccaccaaaggcact
cgggccctggaggcaaccaccgaacacatacggcaggaactggcggttttctgttcccca
gagccacctgccaagacctctaccccagaagacttcatccgaatgaccaagggtatcacc
atggcaacagccaaggccgttgccgctggcaattcctgtcgccaagaagatgtcattgcc
acagccaatctgagccgccgtgctattgcagatatgcttcgggcttgcaaggaagcagct
taccacccggaagtggcccctgatgtgcggcttcgagccctgcactatggccgggagtgt
gccaatggctacctggaactgctggaccatgtgctgctgccgaccctgcagaagccaagc
ccagaactgaagcagcagttgacaggacattcaaagcgtgtggctggttccgtcactgag
ctcatccaggctgctgaagccatgaagggaacagaatgggtggacccagaggaccccaca
gtcattgctgagaatgagctcctgggagctgcagccgccattgaggctgcagctaaaaag
ctagagcagctgaagccccgggccaaacccaaggaggcagatgagtccttgaactttgag
gaacagatactagaagctgccaagtccattgcagcagccaccagtgcactggtaaaggct
gcatcggctgcccagagagaactagtggcccaagggaaggtgggtgccattccagccaat
gcactggacgatggacagtggtctcagggcctcatttctgctgcccggatggtggctgcg
gccaccaacaatctgtgtgaggcagccaatgcagctgtgcaaggccacgctagccaggag
aagctcatctcatcagccaagcaggtagctgcctccacagcccagctccttgtggcctgc
aaggtcaaggctgaccaggactcggaggcaatgaaacgacttcaggctgctggcaacgca
gtgaagcgagcctcagataacctggtgaaagcagcacaaaaggctgcagccttcgaagag
caggagaatgagacagtggtggtgaaagagaagatggtcggcggcattgcccagatcatc
gcagcacaggaagagatgcttcggaaggaacgagagctagaagaggcacggaagaaactg
gcccagatccggcagcagcagtataagttcctgccttcagagcttcgagatgagcactag

KEGG   Macaca mulatta (rhesus monkey): 705008
Entry
705008            CDS       T01028                                 

Gene name
TLN2
Definition
(RefSeq) talin-2 isoform X1
  KO
K06271  talin
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04015  Rap1 signaling pathway
mcc04510  Focal adhesion
mcc04611  Platelet activation
mcc05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    705008 (TLN2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    705008 (TLN2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    705008 (TLN2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    705008 (TLN2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    705008 (TLN2)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   705008 (TLN2)
  Exosomal proteins of other cancer cells
   705008 (TLN2)
SSDB
Motif
Pfam: VBS I_LWEQ Talin_middle FERM_f0 FERM_M FERM_N IRS ACBP
Other DBs
NCBI-GeneID: 705008
NCBI-ProteinID: XP_014997893
Ensembl: ENSMMUG00000011503
LinkDB
Position
7
AA seq 2557 aa
MVALSLKICVRHCNVVKTMQFEPSTAVYDACRVIRERVPEAQTGQASDYGLFLSDEDPRK
GIWLEAGRTLDYYMLRNGDILEYKKKQRPQKIRMLDGSVKTVMVDDSKTVGELLVTICSR
IGITNYEEYSLIQETIDEKKEEGTGTLKKDRTLLRDERKMEKLKAKLHTDDDLNWLDHSR
TFREQGVDENETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFEKACEF
GGFQAQIQFGPHVEHKHKPGFLDLKEFLPKEYIKQRGAEKRIFQEHKNCGEMSEIEAKVK
YVKLARSLRTYGVSFFLVKEKMKGKNKLVPRLLGITKDSVMRVDEKTKEVLQEWPLTTVK
RWAASPKSFTLDFGEYQESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEES
TMLEESVSPKKSTILQQQFNRTGKAEHGSVALPAVMRSGSSGPETFNVGSMPSPQQQVMV
GQMHRGHMPPLTSAQQALMGTINTSMHAVQQAQDDLSELDSLPPLGQDMASRVWVQNKVD
ESKHEIHSQVDAITAGTASVVNLTAGDPADTDYTAVGCAITTISSNLTEMSKGVKLLAAL
MDDEVGSGEDLLRAARTLAGAVSDLLKAVQPTSGEPRQTVLTAAGSIGQASGDLLRQIGE
NETDERFQDVLMSLAKAVANAAAMLVLKAKNVAQVAEDTVLQNRVIAAATQCALSTSQLV
ACAKVVSPTISSPVCQEQLIEAGKLVDRSVENCVRACQAATTDSELLKQVSAAASVVSQA
LHDLLQHVRQFASRGEPIGRYDQATDTIMCVTESIFSSMGDAGEMVRQARVLAQATSDLV
NAMRSDAEAEIDMENSKKLLAAAKLLADSTARMVEAAKGAAANPENEDQQQRLREAAEGL
RVATNAAAQNAIKKKIVNRLEVAAKQAAAAATQTIAASQNAAVSNKNPAAQQQLVQSCKA
VADHIPQLVQGVRGSQAQTEDLSAQLALIISSQNFLQPGSKMVSSAKAAVPTVSDQAAAM
QLSQCAKNLATSLAELRTASQKAHEACGPMEIDSALNTVQTLKNELQDAKMAAVESQLKP
LPGETLEKCAQDLGSTSKAVGSSMAQLLTCAAQGNEHYTGVAARETAQALKTLAQAARGV
AASTTDPAAAHAMLDSARDVMEGSAMLIQEAKQALIAPGDAESQQRLAQVAKAVSHSLNN
CVNCLPGQKDVDVALKSIGESSKKLLVDSLPPSTKPFQEAQSELNQAAADLNQSAGEVVH
ATRGQSGELAAASGKFSDDFDEFLDAGIEMAGQAQTKEDQIQVIGNLKNISMASSKLLLA
AKSLSVDPGAPNAKNLLAAAARAVTESINQLITLCTQQAPGQKECDNALRELETVKGMLD
NPNEPVSDLSYFDCIESVMENSKVLGESMAGISQNAKTGDLPAFGECVGIASKALCGLTE
AAAQAAYLVGISDPNSQAGHQGLVDPIQFARANQAIQMACQNLVDPGSSPSQVLSAATIV
AKHTSALCNACRIASSKTANPVAKRHFVQSAKEVANSTANLVKTIKALDGDFSEDNRSKC
HMATAPLIEAVENLTAFASNPEFVSIPAQISSEGSQAQEPILVSAKTMLESSSYLIRTAR
SLAINPKDPPTWSVLAGHSHTVSDSIKSLITSIRDKAPGQRECDYSIDGINRCIRDIEQA
SLAAVSQSLATRDDISVEALQEQLTSVVQEIGHLIDPIATAARGEAAQLGHKVTQLASYF
EPLILAAVGVASKILDHQQQMTVLDQTKTLAESALQMLYAAKEGGGNPKAQHTHDAITEA
AQLMKEAVDDIMVTLNEAASEVGLVGGMVDAIAEAMSKLDEGTPPEPKGTFVDYQTTVVK
YSKAIAVTAQEMMTKSVTNPEELGGLASQMTSDYGHLAFQGQMAAATAEPEEIGFQIRTR
VQDLGHGCIFLVQKAGALQVCPTDSYTKRELIECARAVTEKVSLVLSALQAGNKGTQACI
TAATAVSGIIADLDTTIMFATAGTLNAENSETFADHRENILKTAKALVEDTKLLVSGAAS
TPDKLAQAAQSSAATITQLAEVVKLGAASLGSDDPETQVVLINAIKDVAKALSDLISATK
GAASKPADDPSMYQLKGAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATIECIKQELTL
FQSKDVPEKTSSPEESIRMTKGITMATTKAVAAGNSCRQEDVIATANLSRKAVSDMLTAC
KQASFHPDVSDEVRTRALRFGTECTLGYLDLLEHVLVILQKPTPELKQQLAAFSKRVAGA
VTELIQAAEAMKGTEWVDPEDPTVIAETELLGAAASIEAAAKKLEQLKPRAKPKQADETL
DFEEQILEAAKSIAAATSALVKSASAAQRELVAQGKVGSIPANAADDGQWSQGLISAARM
VAAATSSLCEAANASVQGHASEEKLISSAKQVAASTAQLLVACKVKADQDSEAMRRLQVM
VTDAGGKILLLERAAGNAVKRASDNLVRAAQKAAFGKADDDDVVVKTKFVGGIAQIIAAQ
EEMLKKERELEEARKKLAQIRQQQYKFLPTELREDEG
NT seq 7674 nt   +upstreamnt  +downstreamnt
atggtggccctgtccttaaagatttgtgtccgccactgcaacgtggtgaagaccatgcag
tttgaaccatctacagctgtgtatgatgcgtgtcgagtcattcgggaacgggtacctgag
gcacaaactgggcaagcttctgactatggactgtttctttcggatgaagaccccaggaaa
gggatctggctggaagcgggcagaacactggattactacatgttgcggaatggggatatt
ttggaatataaaaagaaacagagacctcagaaaatccggatgctggatggatctgtgaag
acggtgatggtggatgattccaagactgtgggggagctcctggtcactatttgtagcaga
ataggaataacaaattatgaagaatactccttaatccaagaaactattgatgaaaagaaa
gaggaaggaacgggcacactcaaaaaagacaggacactgttacgagatgagaggaaaatg
gagaagttgaaggccaagctgcacacagatgatgacctaaattggctggatcacagccga
acattcagagaacaaggagtagatgaaaacgaaacgttgctgcttagacggaagttcttt
tactctgatcagaatgtagattcgagagaccctgtgcagctgaacttgctttatgttcag
gctcgggatgacatcctgaatggctctcaccctgtctccttcgagaaagcctgtgagttt
ggtggatttcaagcccagatacagtttggacctcatgtggaacacaaacataaacctgga
tttttagatctgaaggaattcctgcccaaagaatatatcaagcagagaggagctgaaaag
aggatctttcaggagcataagaactgcggagagatgagtgaaatagaagccaaggtcaag
tacgtcaaactcgcacggtccctccgcacatatggcgtgtccttcttcctggtgaaggaa
aagatgaaaggcaagaacaagctggtgcctcgcctgctggggatcaccaaagactcggtg
atgcgcgtggatgaaaagaccaaggaggtgctgcaggagtggcccctcaccaccgtcaag
cgctgggcagcctcacccaagagcttcacactggattttggggagtatcaggaaagctac
tattcagtacaaaccaccgagggagagcagatatcgcagctgattgcaggctacattgac
atcatcctgaaaaagaaacaaagtaaagatcgatttggactagaaggtgatgaggagtca
accatgttagaagagtccgtttccccaaaaaagtccaccatcttgcagcagcagttcaac
cggaccgggaaggcagagcacggctcagtggcgctgccggccgtgatgcgctcgggctcc
agcgggcctgagaccttcaacgttggcagcatgccttcgccacagcaacaggtcatggtt
gggcagatgcaccgaggccacatgccgccactgacctcagcccagcaggccctgatgggg
acgatcaacacaagcatgcatgccgtccagcaggcccaggatgacctcagtgagctcgac
tcgctgccacctctcggccaggatatggcatctagggtatgggttcagaacaaagtcgat
gaatccaaacacgaaatccattctcaagttgatgctatcacggccggaacggcttcggtt
gttaacctcacggcgggtgaccctgcagacactgactacacagctgtgggatgtgcaatc
accactatttcttccaacctgacggagatgtccaagggtgtgaagctactggccgccctc
atggatgatgaggtgggcagcggggaggacttgctcagagctgccaggaccctcgctggg
gcagtgtcagacttgctgaaagctgtgcagcctacttctggagagcctcgacagacagtt
ttaactgctgctggcagcatcggacaagccagtggggatcttctgagacagattggagag
aatgagactgatgagcgattccaggatgttttaatgagtttggccaaagctgttgccaat
gcagctgccatgttggtactaaaggcaaagaatgttgcccaagtggccgaagatactgtc
ctacagaacagggtaattgccgctgccacccagtgtgccctctccacctcccagcttgtg
gcatgtgccaaggttgtgagccccactatcagctcccctgtgtgccaggagcagctgatt
gaagcagggaagctggtggaccgctcagtggagaactgtgtccgtgcctgccaggcggcc
accaccgacagtgagctcctgaagcaggtcagcgcagcggccagcgtggtcagccaggcc
ctccatgatctcctgcagcatgtgcggcagtttgccagccgaggcgagcccattggccgc
tacgaccaggccaccgacaccatcatgtgtgtcactgagagcatcttcagctccatgggt
gatgctggtgaaatggtgcgccaggcgcgggtcctggcccaagccacatcagacctcgtc
aatgccatgaggtcagatgcagaagccgaaatcgacatggagaattcgaagaagctcctg
gcagcagcaaaactcttagccgactccactgctcgcatggtggaagctgcaaagggggct
gcagccaacccggagaatgaggaccagcagcaaaggctgagagaagctgcagaaggcctc
cgggtagcaaccaacgcagctgcccagaatgctattaagaaaaaaattgtcaaccgactg
gaggttgcagccaagcaggccgcagcagcagccacacagaccattgccgcctcccagaat
gcagctgtttccaacaagaaccctgcggcccagcagcagctggttcagagttgcaaggca
gtggctgatcacatccctcaactggtccagggagtgagggggagccaagctcaaaccgaa
gacctgagtgcccagctggctctcatcatctccagccagaacttcctccagcctggaagc
aagatggtgtcctctgccaaagccgcagtgcccaccgtgagtgaccaggccgcagccatg
cagctgagccagtgtgccaagaacctggccaccagcttggcggagctgcgtaccgcctcg
cagaaggcccatgaagcctgtggtccgatggaaatcgattcagctctgaatactgtgcag
acgcttaagaatgaactgcaggatgccaagatggcggccgtggagagccagctgaagcca
cttccaggcgaaacgctggaaaaatgtgctcaggacctgggaagcacatccaaggcagtg
ggctcctccatggcacagctgctgacctgtgctgctcaaggcaacgaacactacacaggg
gtggctgctagagagacggcccaagctctgaaaacgctggcccaggccgcccgtggagtg
gctgcatcgacgaccgaccccgcggctgcccatgccatgttagattctgctcgagacgtg
atggagggctccgccatgctcattcaagaggccaagcaggccctgattgcacctggagat
gcagagagtcaacaaagactggctcaggtggctaaagccgtctctcactccttgaataac
tgcgtaaattgcctccctgggcagaaggatgtggacgtggccttgaagagcatcggggag
tccagcaagaagctgcttgtggattcgctacctccaagcacgaagcctttccaggaagcc
cagagtgaactgaaccaggcagcagctgatctgaaccagtctgctggggaagttgtccat
gccacccggggccagagtggagagttggctgcagcctctggaaagttcagcgatgatttt
gatgaattcctcgatgctggcattgagatggctggccaggcgcagacgaaagaagaccag
atccaagtgataggaaacctcaagaatatctcgatggcatccagcaagctgctgttagct
gccaagtctctctctgtagatccaggagctcccaacgcaaaaaatctcctggctgcagct
gcaagagctgtgacagagagcatcaatcaactcatcactctgtgtacccaacaagctccg
ggccagaaagagtgcgataatgccctgcgggagctcgagactgtgaaggggatgttggac
aatcctaatgaacctgttagtgacctctcttactttgactgcattgagagtgtgatggaa
aactccaaggttctgggtgaatcgatggcagggatttcacagaacgccaagactggggac
ctccctgcctttggggaatgtgtggggattgcatccaaggctctctgtggactgacagag
gccgcagcccaggctgcatacttggttggcatctctgatccaaacagccaggcaggccac
cagggcctggtggaccccatccagtttgccagggctaaccaggccatccagatggcatgc
cagaacttggtggaccctggcagcagcccatcacaggtcctgtcagctgccacaattgtt
gccaagcacacatcagccttgtgcaatgcctgccgcatcgcctcatccaagacggccaac
ccagtagccaagaggcactttgtccagtcagccaaggaagtcgccaacagcactgccaac
ctggtgaagaccatcaaggccctggatggggatttctctgaagacaaccgcagtaagtgt
cacatggccaccgcacccttgattgaagctgtggagaacctgacggcgtttgcctcgaac
cctgagtttgtcagcattcccgcccagatcagctccgagggttcccaggcacaggaacca
atcctggtttcagccaagaccatgctggagagttcatcgtacctcattcgcactgcacgc
tctctggccatcaaccccaaagacccacccacctggtctgtgctggctgggcattcccac
acagtgtccgactccatcaagagcctcatcacttctatcagggacaaggcccctggacag
agggagtgtgattactccatcgatggcatcaaccggtgcatccgggacatcgagcaggcc
tcgctggctgctgtcagccagagcctggccacaagggacgacatctctgtggaggccctg
caggagcagctgacttcggtggtccaggaaatcgggcaccttattgatcccatcgccaca
gcggctcggggagaagcagctcagctgggacataaggtgacacaactggcaagctatttt
gagcccttgatcttagccgcagtcggtgtggcctccaagattcttgaccatcagcagcag
atgacggtgctggaccagaccaagacgctcgcagagtctgccttgcagatgttgtacgca
gccaaagaaggtggcggaaaccccaaggcgcagcacacccatgacgccatcacagaggcc
gcccagctgatgaaggaagcggtggacgacatcatggtgacgctgaacgaagctgccagt
gaagtggggctggttgggggcatggtggacgccattgcagaggctatgagcaagctggat
gaaggcactcctccagaaccaaagggaacatttgtcgactatcagacaactgtggttaaa
tactccaaagccattgcggtgacagctcaggaaatgatgactaagtcggttactaacccg
gaggagttgggaggactggcttcacaaatgaccagtgactatgggcacctggctttccag
ggccagatggcagcagccacggcggaaccagaggagatcggattccagattcgcactcgt
gtgcaggacctgggccacggctgtatcttcctggtgcagaaggcaggggccctccaggtc
tgccccacagacagctacaccaagagggagctgatcgagtgcgcccgcgccgtcacggag
aaggtctccttggtgctctcagctctgcaggccgggaacaaaggaacccaggcatgcatt
acagctgccaccgctgtgtctgggatcattgccgacctggacaccaccattatgtttgca
acagcggggacgctaaatgcagagaacagtgagaccttcgcagaccacagggagaacatt
ctcaagacagccaaggccttggtggaagacacaaaactacttgtgtcaggagctgcgtcc
actcctgacaagctggcccaggcggcccagtcctcagcagccaccatcacccagctcgca
gaagtggtcaagctgggggcagccagcctgggctccgacgaccccgagacccaggtggtt
ttgatcaacgccatcaaagatgtagccaaggccctttccgatctcatcagtgctaccaag
ggagctgccagcaagccagcggacgacccttccatgtaccagctcaagggggccgccaag
gtgatggtgactaatgtcacctccctcctcaagactgtaaaggcggtggaggatgaggcc
acccggggcaccagggcgcttgaggccacaatcgaatgcataaagcaggagcttacgttg
ttccagtcaaaagatgtacctgaaaagacatcatcacctgaagaatccataaggatgacg
aaaggcatcaccatggcaacaaccaaagccgtggcagctggaaactcgtgtagacaggag
gacgtgattgctactgccaacctgagccggaaagccgtttcagatatgttgacggcttgc
aagcaagcatccttccaccccgatgtcagtgacgaggtgagaaccagagccttgcgtttc
gggacggagtgcaccctcggctacttggacctcctggagcacgtcttggtgattcttcag
aaaccaaccccagaactcaagcagcagctggctgctttctccaagcgagtggccggtgct
gtgacagagctcatccaggcggcggaagccatgaaaggaacagagtgggtggatccagaa
gacccaactgtcattgcagaaacagagttactgggggctgcagcatccatcgaagctgct
gctaagaagttagagcaactgaagccaagagcaaaaccaaaacaagcggatgagaccctg
gactttgaggaacagatcttggaagctgctaaatccattgctgctgccacaagcgccctg
gtcaaatcggcctcagcagcccagagggagctggtggcccaaggaaaggtgggctccatc
cctgccaatgctgcagacgacggacagtggtcacaggggctgatttctgctgcccggatg
gtggcggctgcgaccagcagtctctgtgaggcggccaatgcctctgttcagggacacgcc
agtgaggagaagctcatctcatctgccaagcaggtcgccgcttccacggctcagctgctg
gtggcctgcaaggtgaaggccgaccaggattcagaggccatgaggcggctacaggtaatg
gtcactgatgctggtgggaaaatactcctgttggagcgggcggcaggaaatgctgtgaaa
agagcctcagacaatcttgtccgtgcagcccagaaggcagcatttggcaaagctgatgat
gacgatgttgtagtgaaaaccaagtttgtggggggcattgctcagatcatcgctgcccag
gaagaaatgctaaagaaagagcgagaactggaagaagcaaggaaaaaactggcccaaatc
cgccagcagcagtataagtttttacccaccgagctgagggaagatgagggctaa

DBGET integrated database retrieval system