KEGG   Macaca mulatta (rhesus monkey): 696306
Entry
696306            CDS       T01028                                 

Definition
(RefSeq) T cell receptor beta variable 3-1
  KO
K10785  T-cell receptor beta chain V region
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04020  Calcium signaling pathway
mcc04064  NF-kappa B signaling pathway
mcc04514  Cell adhesion molecules
mcc04612  Antigen processing and presentation
mcc04658  Th1 and Th2 cell differentiation
mcc04659  Th17 cell differentiation
mcc04660  T cell receptor signaling pathway
mcc04672  Intestinal immune network for IgA production
mcc04940  Type I diabetes mellitus
mcc05135  Yersinia infection
mcc05142  Chagas disease
mcc05144  Malaria
mcc05150  Staphylococcus aureus infection
mcc05162  Measles
mcc05166  Human T-cell leukemia virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05202  Transcriptional misregulation in cancer
mcc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mcc05310  Asthma
mcc05320  Autoimmune thyroid disease
mcc05321  Inflammatory bowel disease
mcc05322  Systemic lupus erythematosus
mcc05323  Rheumatoid arthritis
mcc05330  Allograft rejection
mcc05332  Graft-versus-host disease
mcc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    696306
   04015 Rap1 signaling pathway
    696306
   04064 NF-kappa B signaling pathway
    696306
   04020 Calcium signaling pathway
    696306
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    696306
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    696306
   04660 T cell receptor signaling pathway
    696306
   04658 Th1 and Th2 cell differentiation
    696306
   04659 Th17 cell differentiation
    696306
   04672 Intestinal immune network for IgA production
    696306
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    696306
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    696306
  09163 Immune disease
   05310 Asthma
    696306
   05322 Systemic lupus erythematosus
    696306
   05323 Rheumatoid arthritis
    696306
   05320 Autoimmune thyroid disease
    696306
   05321 Inflammatory bowel disease
    696306
   05330 Allograft rejection
    696306
   05332 Graft-versus-host disease
    696306
  09166 Cardiovascular disease
   05416 Viral myocarditis
    696306
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    696306
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    696306
   05150 Staphylococcus aureus infection
    696306
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    696306
   05170 Human immunodeficiency virus 1 infection
    696306
   05162 Measles
    696306
   05169 Epstein-Barr virus infection
    696306
  09174 Infectious disease: parasitic
   05144 Malaria
    696306
   05142 Chagas disease
    696306
SSDB
Motif
Pfam: V-set Ig_3 I-set
Other DBs
NCBI-GeneID: 696306
NCBI-ProteinID: XP_014990593
LinkDB
Position
3
AA seq 221 aa
MKRRSHARGEPGNGEMITGCDLTGAAPLSGSGKHSLDFSPLHTRILPRALPGLPDSAMGC
RLLCCVTLCLLQAGSLDTAVSQTPKYLVTQTGKEESLKCEQNLGHDTMYWYKQDSKKLLK
IMFSYNNKKLFINETVSNRFSPDSPDKARLILHIKPLELGDSAVYFCASSQGTALQSHRI
PVHKPPSSARKLWASVCTCTQGSSLHCLMASDGVSVCSTDG
NT seq 666 nt   +upstreamnt  +downstreamnt
atgaaaaggaggagccatgctagaggagagcctgggaatggggaaatgattacaggctgt
gacctcactggcgcagcccctctcagcggcagtggaaagcacagcctagacttctcacca
ctgcacaccagaatcctgccccgggccttgcctggtctgcctgactctgccatgggctgc
aggctcctctgctgtgtgaccctctgcctcctccaagcaggttccttggacacagctgtt
tcccagactccaaaatacctggtcacacagacaggaaaggaggagtcccttaaatgtgaa
caaaatctgggtcatgatactatgtattggtataagcaggactctaagaaattgctgaag
ataatgtttagctacaataacaagaagctctttataaatgaaacagtttcaaatcgcttc
tcacctgactctccagacaaagctcgtttaattcttcacatcaagcccctggagcttggt
gactctgctgtatatttctgtgccagcagccaaggcacagccctgcagagtcaccgcatt
cctgtgcacaaacctcccagctcagccaggaagctgtgggccagtgtgtgcacctgcacc
caaggctccagtctccactgtctgatggcctctgatggagtttcagtctgtagtacagac
ggctag

KEGG   Macaca mulatta (rhesus monkey): 697904
Entry
697904            CDS       T01028                                 

Definition
(RefSeq) uncharacterized protein LOC697904
  KO
K10785  T-cell receptor beta chain V region
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04020  Calcium signaling pathway
mcc04064  NF-kappa B signaling pathway
mcc04514  Cell adhesion molecules
mcc04612  Antigen processing and presentation
mcc04658  Th1 and Th2 cell differentiation
mcc04659  Th17 cell differentiation
mcc04660  T cell receptor signaling pathway
mcc04672  Intestinal immune network for IgA production
mcc04940  Type I diabetes mellitus
mcc05135  Yersinia infection
mcc05142  Chagas disease
mcc05144  Malaria
mcc05150  Staphylococcus aureus infection
mcc05162  Measles
mcc05166  Human T-cell leukemia virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05202  Transcriptional misregulation in cancer
mcc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mcc05310  Asthma
mcc05320  Autoimmune thyroid disease
mcc05321  Inflammatory bowel disease
mcc05322  Systemic lupus erythematosus
mcc05323  Rheumatoid arthritis
mcc05330  Allograft rejection
mcc05332  Graft-versus-host disease
mcc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    697904
   04015 Rap1 signaling pathway
    697904
   04064 NF-kappa B signaling pathway
    697904
   04020 Calcium signaling pathway
    697904
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    697904
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    697904
   04660 T cell receptor signaling pathway
    697904
   04658 Th1 and Th2 cell differentiation
    697904
   04659 Th17 cell differentiation
    697904
   04672 Intestinal immune network for IgA production
    697904
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    697904
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    697904
  09163 Immune disease
   05310 Asthma
    697904
   05322 Systemic lupus erythematosus
    697904
   05323 Rheumatoid arthritis
    697904
   05320 Autoimmune thyroid disease
    697904
   05321 Inflammatory bowel disease
    697904
   05330 Allograft rejection
    697904
   05332 Graft-versus-host disease
    697904
  09166 Cardiovascular disease
   05416 Viral myocarditis
    697904
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    697904
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    697904
   05150 Staphylococcus aureus infection
    697904
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    697904
   05170 Human immunodeficiency virus 1 infection
    697904
   05162 Measles
    697904
   05169 Epstein-Barr virus infection
    697904
  09174 Infectious disease: parasitic
   05144 Malaria
    697904
   05142 Chagas disease
    697904
SSDB
Motif
Pfam: V-set Ig_3
Other DBs
NCBI-GeneID: 697904
NCBI-ProteinID: XP_028702413
LinkDB
Position
3
AA seq 324 aa
MSQKGTVSLETSLSISPEPGIHQHQPDFSVPLRQCIHSPVQPAALCTKRAATAKSRPRTH
SALPQEDQALHQVQCCLPHCAMGPGLLSWALLCLLGAGESCALDSSPILSLPTPVSSTLP
RGGPPGCLLAHPPSAFPTGSVDTGVTQSPTHLIKTRGQQVTLRCSPISGHSTVSWYQQAP
GQGPQFIFEYANELRTSEGNFPHRFSGRQFCDYHHSELNVSALELGDSALYLCASSLAQP
GRVTGTLCTNLSASVYSSLRADSCEKGWRKQGQEDLLRGCCCFRRFTAKLPSLSDAVHYN
DTVAGTLLFRKRNSFWCQGCSTDV
NT seq 975 nt   +upstreamnt  +downstreamnt
atgtcacagaagggtacagtgtctctggaaacaagcctgagcatttcccctgagcctggc
atccaccagcaccagccggacttctctgtacctctgcggcagtgcatccacagccctgta
cagccagctgctctctgcaccaaaagggcagccacagcaaaatcaaggcccagaactcac
tcagctcttccccaggaggaccaagccctgcatcaggtgcagtgctgcctgccccactgt
gccatgggccccgggctcctctcctgggcgctgctttgtctcctgggagcaggtgagtcc
tgtgcactggacagcagccccattctcagccttcccacccctgtgtcctccactttacct
cggggaggacctccaggctgtctcctggctcatcctccatctgcttttcccacaggctca
gtggacactggagtcacccaaagtcccacacacctgatcaaaacgagaggacagcaagtg
actctgagatgctctcctatctctgggcacagcactgtgtcctggtaccaacaggcccct
ggtcaggggccccagtttatcttcgaatatgctaatgagttaaggacatcagaaggaaac
ttccctcatcgattctcagggcgccagttctgtgactatcatcactctgagctgaatgtg
agcgccttggagctgggggactcggccctgtatctctgtgccagcagcttggcacagcct
ggcagagtcactggaactctgtgcactaatctctctgcttccgtgtacagcagtctcaga
gcagacagctgtgagaaaggctggcggaaacaaggccaggaggatctgctcagaggatgc
tgctgcttcaggaggttcacagcaaaattaccttctttgtcggatgccgtacactataat
gatacagtagctggcactctcctttttagaaaaagaaattcattttggtgtcagggttgt
tcgacagatgtgtag

KEGG   Macaca mulatta (rhesus monkey): 698785
Entry
698785            CDS       T01028                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: uncharacterized protein LOC698785
  KO
K10785  T-cell receptor beta chain V region
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04020  Calcium signaling pathway
mcc04064  NF-kappa B signaling pathway
mcc04514  Cell adhesion molecules
mcc04612  Antigen processing and presentation
mcc04658  Th1 and Th2 cell differentiation
mcc04659  Th17 cell differentiation
mcc04660  T cell receptor signaling pathway
mcc04672  Intestinal immune network for IgA production
mcc04940  Type I diabetes mellitus
mcc05135  Yersinia infection
mcc05142  Chagas disease
mcc05144  Malaria
mcc05150  Staphylococcus aureus infection
mcc05162  Measles
mcc05166  Human T-cell leukemia virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05202  Transcriptional misregulation in cancer
mcc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mcc05310  Asthma
mcc05320  Autoimmune thyroid disease
mcc05321  Inflammatory bowel disease
mcc05322  Systemic lupus erythematosus
mcc05323  Rheumatoid arthritis
mcc05330  Allograft rejection
mcc05332  Graft-versus-host disease
mcc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    698785
   04015 Rap1 signaling pathway
    698785
   04064 NF-kappa B signaling pathway
    698785
   04020 Calcium signaling pathway
    698785
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    698785
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    698785
   04660 T cell receptor signaling pathway
    698785
   04658 Th1 and Th2 cell differentiation
    698785
   04659 Th17 cell differentiation
    698785
   04672 Intestinal immune network for IgA production
    698785
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    698785
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    698785
  09163 Immune disease
   05310 Asthma
    698785
   05322 Systemic lupus erythematosus
    698785
   05323 Rheumatoid arthritis
    698785
   05320 Autoimmune thyroid disease
    698785
   05321 Inflammatory bowel disease
    698785
   05330 Allograft rejection
    698785
   05332 Graft-versus-host disease
    698785
  09166 Cardiovascular disease
   05416 Viral myocarditis
    698785
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    698785
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    698785
   05150 Staphylococcus aureus infection
    698785
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    698785
   05170 Human immunodeficiency virus 1 infection
    698785
   05162 Measles
    698785
   05169 Epstein-Barr virus infection
    698785
  09174 Infectious disease: parasitic
   05144 Malaria
    698785
   05142 Chagas disease
    698785
SSDB
Motif
Pfam: V-set
Other DBs
NCBI-GeneID: 698785
NCBI-ProteinID: XP_014990585
LinkDB
Position
3
AA seq 268 aa
MDMWTLCSTCSTFTFGTLQGRNDTWDSRARDPPKGTVGKGWPAEESCSRFINAQTQKTPP
SCSICHEHRPPVLCGLLSPVGRSSECWCHSDPKIPGPKTGQSMTLQCAQDMNHDYMYWYR
QDPGMGLRLIHYSVGEGSTEKGEVPDGYNVTRSNTEDFPLRLESAAPSQTSVYFCASSYS
TALQGCLLSAHKARQALPSSPTQDSGMPWAEFSTPESLESRMTPSGPGMLAHPTGHAQQT
EERLWDEKMNSEMQCEASGYRKLWSPKR
NT seq 807 nt   +upstreamnt  +downstreamnt
atggacatgtggacactgtgttccacctgctccacctttacttttgggacccttcagggc
aggaatgatacatgggatagcagagccagggacccgcctaagggtacagtgggcaaagga
tggcctgcagaggagtcctgttcccgtttcatcaatgcacagacccagaagacccctccg
tcatgcagcatctgccatgagcatcggcctcctgtgctgtgcggccttttgtctcctgtg
ggcaggtccagtgaatgctggtgtcactcagaccccaaaattccaggtcctaaaacagga
cagagcatgacactgcagtgtgcccaggatatgaaccatgactacatgtactggtatcga
caagacccaggcatggggctgaggctgattcattactcagttggtgaaggtagcactgag
aaaggagaagtccccgatggctacaatgtcaccagatcaaacacagaggatttcccactc
agactggagtcggctgctccctcccagacatctgtgtacttctgtgccagcagttactcc
acagcgttacaaggctgcctcctctctgcacataaagccaggcaggctctgccctcctcc
cccacccaagactcagggatgccctgggcagagttctctacaccagagtccttggaatcc
cgaatgaccccaagtggcccaggcatgttggcgcatcctacaggacatgcccagcagaca
gaggagcggctgtgggatgagaagatgaactcagagatgcagtgtgaggcctccgggtac
agaaagctctggagtccaaagcgatga

KEGG   Macaca mulatta (rhesus monkey): 703029
Entry
703029            CDS       T01028                                 

Definition
(RefSeq) immunoglobulin lambda-1 light chain-like
  KO
K10785  T-cell receptor beta chain V region
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04020  Calcium signaling pathway
mcc04064  NF-kappa B signaling pathway
mcc04514  Cell adhesion molecules
mcc04612  Antigen processing and presentation
mcc04658  Th1 and Th2 cell differentiation
mcc04659  Th17 cell differentiation
mcc04660  T cell receptor signaling pathway
mcc04672  Intestinal immune network for IgA production
mcc04940  Type I diabetes mellitus
mcc05135  Yersinia infection
mcc05142  Chagas disease
mcc05144  Malaria
mcc05150  Staphylococcus aureus infection
mcc05162  Measles
mcc05166  Human T-cell leukemia virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05202  Transcriptional misregulation in cancer
mcc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mcc05310  Asthma
mcc05320  Autoimmune thyroid disease
mcc05321  Inflammatory bowel disease
mcc05322  Systemic lupus erythematosus
mcc05323  Rheumatoid arthritis
mcc05330  Allograft rejection
mcc05332  Graft-versus-host disease
mcc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    703029
   04015 Rap1 signaling pathway
    703029
   04064 NF-kappa B signaling pathway
    703029
   04020 Calcium signaling pathway
    703029
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    703029
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    703029
   04660 T cell receptor signaling pathway
    703029
   04658 Th1 and Th2 cell differentiation
    703029
   04659 Th17 cell differentiation
    703029
   04672 Intestinal immune network for IgA production
    703029
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    703029
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    703029
  09163 Immune disease
   05310 Asthma
    703029
   05322 Systemic lupus erythematosus
    703029
   05323 Rheumatoid arthritis
    703029
   05320 Autoimmune thyroid disease
    703029
   05321 Inflammatory bowel disease
    703029
   05330 Allograft rejection
    703029
   05332 Graft-versus-host disease
    703029
  09166 Cardiovascular disease
   05416 Viral myocarditis
    703029
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    703029
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    703029
   05150 Staphylococcus aureus infection
    703029
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    703029
   05170 Human immunodeficiency virus 1 infection
    703029
   05162 Measles
    703029
   05169 Epstein-Barr virus infection
    703029
  09174 Infectious disease: parasitic
   05144 Malaria
    703029
   05142 Chagas disease
    703029
SSDB
Motif
Pfam: C1-set C2-set_2 Ig_3
Other DBs
NCBI-GeneID: 703029
NCBI-ProteinID: XP_028702415
LinkDB
Position
3
AA seq 371 aa
MAMLIRGMNKSPNDMVRYLWGSGHWAIQGPPRRKRGLRQGPQGCANTAQLFFGEGSRLTV
LGKEAVGAPERSERAGWAELSSCPTPRGAVLRGAAGRLGRGVLVLGAGRAMGLSAVGRTR
AESGIAGRAAPVFVLGLQAVSTDPQYFGPGTRLTVLAGGAGGPGERRRSGFCVGLGGRDQ
ETQYFGPGTRLLVLEDLKKVFPPKVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWW
VNGKEVHSGVSTDPQPLKEQPTLEDSRYCLSSRLRVSATFWHNPRNHFRCQVQFYGLSED
DEWTEDRDKPITQKISAEAWGRADCGFTSESYQQGVLSATILYEILLGKATLYAVLVSAL
VLMAMVKRKDS
NT seq 1116 nt   +upstreamnt  +downstreamnt
atggccatgctgatcagaggcatgaacaaaagccctaatgacatggttaggtacctctgg
ggaagtggacactgggccatccagggccctcctcggcgaaagcggggtttgcgccagggt
ccccagggctgtgctaacaccgcgcagctgttctttggagaaggctctaggctgaccgtg
ctgggtaaggaggcggttggggctccggagcgctccgagagggcgggatgggcagagttg
agcagctgccccactccgagaggggctgtgctgagaggcgctgctgggcgtctgggccga
ggagtcctggttctgggtgctgggagggcgatggggctctcagcggtgggaaggacccga
gctgagtctgggatagcagggcgggcagcaccggtttttgtcctgggcctccaggctgtg
agcacagatccgcagtattttggcccaggcacccggctgacagtgctcgctgggggcgcc
gggggacctggggagagacggcgctcgggtttttgtgtggggctcgggggccgtgaccaa
gagacccagtacttcggaccaggcacgcggctcctggtgctcgaggacctgaaaaaagtg
ttcccacccaaggtcgctgtgtttgagccatcagaagcagagatctcccacacccaaaag
gccacgctggtgtgcctggccacaggcttctaccccgaccacgtggagttgagctggtgg
gtgaacgggaaagaggtgcacagtggggtcagcacggacccacagcccctcaaggagcag
cccaccctcgaggactccagatactgcctgagcagccgcctgagggtctcggccaccttc
tggcacaacccccgcaaccacttccgctgccaagtccagttctatgggctctcggaggat
gacgagtggaccgaggacagggacaagcccatcacccaaaagatcagcgctgaggcctgg
ggtagagcagactgtggcttcacctctgagtcttaccagcaaggggtcctgtctgccacc
atcctctatgagatcttgctagggaaggccaccttgtatgccgtgctggtcagtgccctc
gtgctgatggccatggtcaagagaaaggattcctga

KEGG   Macaca mulatta (rhesus monkey): 710149
Entry
710149            CDS       T01028                                 

Definition
(RefSeq) uncharacterized protein LOC710149
  KO
K10784  T cell receptor alpha chain V region
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04020  Calcium signaling pathway
mcc04064  NF-kappa B signaling pathway
mcc04514  Cell adhesion molecules
mcc04612  Antigen processing and presentation
mcc04658  Th1 and Th2 cell differentiation
mcc04659  Th17 cell differentiation
mcc04660  T cell receptor signaling pathway
mcc04672  Intestinal immune network for IgA production
mcc04940  Type I diabetes mellitus
mcc05135  Yersinia infection
mcc05142  Chagas disease
mcc05144  Malaria
mcc05150  Staphylococcus aureus infection
mcc05162  Measles
mcc05166  Human T-cell leukemia virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05202  Transcriptional misregulation in cancer
mcc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mcc05310  Asthma
mcc05320  Autoimmune thyroid disease
mcc05321  Inflammatory bowel disease
mcc05322  Systemic lupus erythematosus
mcc05323  Rheumatoid arthritis
mcc05330  Allograft rejection
mcc05332  Graft-versus-host disease
mcc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    710149
   04015 Rap1 signaling pathway
    710149
   04064 NF-kappa B signaling pathway
    710149
   04020 Calcium signaling pathway
    710149
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    710149
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    710149
   04660 T cell receptor signaling pathway
    710149
   04658 Th1 and Th2 cell differentiation
    710149
   04659 Th17 cell differentiation
    710149
   04672 Intestinal immune network for IgA production
    710149
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    710149
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    710149
  09163 Immune disease
   05310 Asthma
    710149
   05322 Systemic lupus erythematosus
    710149
   05323 Rheumatoid arthritis
    710149
   05320 Autoimmune thyroid disease
    710149
   05321 Inflammatory bowel disease
    710149
   05330 Allograft rejection
    710149
   05332 Graft-versus-host disease
    710149
  09166 Cardiovascular disease
   05416 Viral myocarditis
    710149
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    710149
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    710149
   05150 Staphylococcus aureus infection
    710149
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    710149
   05170 Human immunodeficiency virus 1 infection
    710149
   05162 Measles
    710149
   05169 Epstein-Barr virus infection
    710149
  09174 Infectious disease: parasitic
   05144 Malaria
    710149
   05142 Chagas disease
    710149
SSDB
Motif
Pfam: V-set Ig_3 Ig_2 ig I-set
Other DBs
NCBI-GeneID: 710149
NCBI-ProteinID: XP_014998747
UniProt: A0A5F7ZUA6
LinkDB
Position
7
AA seq 228 aa
MLFASCSGLVILLIIRRTNGDSVTQTEGPVTLPERAALTLNCTYQTSYSAFIFWYVQYPN
KEPELLLKSSENQETNSRGFQASHVKSDSSFHLEKPSVQLSDSAVYYCVLRDTVGGTAAR
AQHKPRGPQVGPGCQRLWEGALFSVSRVLPCSLPPCNSSSDSLVPRSHGDFTLHHTEELG
EEQSKAEPKLCFLEMLLSSVQMSLLPLRWHTFLRSDINLLCDSSVGLC
NT seq 687 nt   +upstreamnt  +downstreamnt
atgctgtttgcttcctgctcaggacttgtgatcttgttgataatcagaaggaccaatgga
gactcagtgacccagacagaaggtccagttaccctccctgagagggcagctctaacatta
aactgcacttatcagaccagctattcagcttttatattctggtatgtccagtatccaaac
aaagagcctgagctcctcctgaaaagttcagaaaaccaggagacgaacagcagaggtttt
caggccagtcatgtcaagagtgacagttccttccatctggagaaaccctcggtgcagctg
tcggactctgccgtgtactactgtgttctgagagacacagtgggagggactgcagcgaga
gcccagcacaaaccccgggggccgcaggtggggcctgggtgtcagcggctttgggagggg
gcgttattttctgtctccagggttctaccctgcagccttcctccatgtaattccagctct
gattctttggtgccaagaagccatggagattttacattacaccacacagaggaattgggg
gaggaacagtctaaagcagaacctaagctctgttttctagaaatgcttctgtcctcagtc
cagatgtctcttcttcccctcagatggcatacattcctgagaagtgacattaacttgcta
tgtgacagttcagttggtctatgctga

DBGET integrated database retrieval system