KEGG   Macaca mulatta (rhesus monkey): 696336
Entry
696336            CDS       T01028                                 

Gene name
PXN
Definition
(RefSeq) paxillin isoform X1
  KO
K05760  paxillin
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04062  Chemokine signaling pathway
mcc04370  VEGF signaling pathway
mcc04510  Focal adhesion
mcc04670  Leukocyte transendothelial migration
mcc04810  Regulation of actin cytoskeleton
mcc05100  Bacterial invasion of epithelial cells
mcc05135  Yersinia infection
mcc05163  Human cytomegalovirus infection
mcc05165  Human papillomavirus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05203  Viral carcinogenesis
mcc05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    696336 (PXN)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    696336 (PXN)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    696336 (PXN)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    696336 (PXN)
   04062 Chemokine signaling pathway
    696336 (PXN)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    696336 (PXN)
   05203 Viral carcinogenesis
    696336 (PXN)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    696336 (PXN)
   05100 Bacterial invasion of epithelial cells
    696336 (PXN)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    696336 (PXN)
   05163 Human cytomegalovirus infection
    696336 (PXN)
   05165 Human papillomavirus infection
    696336 (PXN)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mcc04990]
    696336 (PXN)
Domain-containing proteins not elsewhere classified [BR:mcc04990]
 LIM domain-containing proteins
  Paxillin family proteins
   696336 (PXN)
SSDB
Motif
Pfam: Paxillin LIM
Other DBs
NCBI-GeneID: 696336
NCBI-ProteinID: XP_028685802
LinkDB
Position
11
AA seq 1082 aa
MDDLDALLADLESTTSHISKRPVFLSEETPYSYPTGNHTYQEIAVPPPVPPPPSSEALNG
TILDPLDQWQPSGSRFIHQQPQSSSPVYGSSAKTSSASNPQDSVGSPCSRVGEEEHVYSF
PNKQKSAEPSPTVMSTSLGSNLSELDRLLLELNAVQHNPPGFPADEANSSPPLPGALSPH
YGVPETNSPLGGKAGPLTKEKPKRNGGRGLEDVRPSVESLLDELESSVPSPVPAITVNQG
EMSSPQRVTSTQQQTRISASSATRELDELMASLSDFKTSSSTVALSAPGLLPGSAPSSYC
SLPPSPPPIPSVFLPPTTKPSPRGQGHTPEFPCTEQSGRDLLPPVAPSWLDLAGLGVMPD
ILNSRSPSVEGSLWAVGTESQGRDWRHLPTLTHELSGAPRGHTVPYAGSIGPQEPGEPQG
PPASPSCPEEALAATREQPWASEVFRPERMPPSGAARSFQEVIEPAIVAVDRQAVFPDTW
TLTEERGLQQERPRPEPGRLGSSSPASVTMEQLGAKMTERGSVARPTQGPETPGSPEGTT
EAATQAGKEQPELPCAMATSTPSTMERISTSGQIRSVIRRSRETGHAHPMSREPSPRRRL
DPATLSRTPSQEQLIAELQGRLGIQPEAEELAEAAGPSAQDWLTEGIVITVQPRGKRAGG
QLVEKVVFPPGSPIPLRRTISVLASPSVPLLQHRTDAAASSSSPLPSLPTSSPLGPSAYT
CGSSGVQSPGEEPHDEGVQGPTLSTPAPHTMRSVGCQTDEDPLFPPMQIQGLEQRADGER
CWAAGWPRDSGRSSPGGQDEGGFMAQGKTGSSSPPGGPPKPGSQLDSMLGSLQSDLNKLG
VATVAKGVCGACKKPIAGQVVTAMGKTWHPEHFVCTHCQEEIGSRNFFERDGQPYCEKDY
HNLFSPRCYYCNGPILDKVVTALDRTWHPEHFFCAQCGAFFGPEGFHEKDGKAYCRKDYF
DMFAPKCGGCARAILENYISALNTLWHPECFVCRECFTPFVNGSFFEHDGQPYCEVHYHE
RRGSLCSGCQKPITGRCITAMAKKFHPEHFVCAFCLKQLNKGTFKEQNDKPYCQNCFLKL
FC
NT seq 3249 nt   +upstreamnt  +downstreamnt
atggacgacctcgacgccctgctggcggacttggagtccaccacctcccacatctccaaa
cggcctgtgttcttgtcggaggagaccccctactcatacccaactggaaaccacacatac
caggagatcgccgtgccaccccccgtccccccacccccgtccagcgaggccctcaatggc
acaatccttgaccctttagaccagtggcagcccagtggctcccgattcatccaccagcag
cctcagtcctcatcacctgtgtacggctccagtgccaaaacttccagtgcctccaaccct
caggacagcgttggctctccgtgctcccgagtgggtgaggaggagcacgtctacagcttc
cccaacaagcagaaatcagctgagccttcacccaccgtaatgagcacgtccctgggcagc
aacctttctgaactcgaccgcctgctgctggaactgaatgctgtgcagcataacccacca
ggcttccctgcagatgaggccaactcaagccccccgcttcctggggccctgagcccccac
tatggtgtcccagagactaacagccccctgggaggcaaagctgggcccctgacgaaagag
aagcctaagcggaatgggggccggggcctggaggacgtgcggcccagcgtggagagtctc
ttggatgaactggagagctccgtgcccagccccgtccctgccatcactgtgaaccagggc
gagatgagcagcccgcagcgcgtcacctccacccagcagcagacgcgcatctcagcctcc
tctgccaccagggagctggacgagctgatggcttcgctgtcggatttcaagaccagctcc
tccactgtggctctgagtgccccggggctgctgcccggctctgctccatcctcatactgc
tcccttcctccttctcctcctcccataccatctgtattcctgccacccaccactaaaccc
tcccctcgaggccagggccacactccggagttcccttgtactgagcagagtggacgagac
cttctacctcctgtggcccctagctggcttgatttggctggtcttggggtgatgcctgat
atcctcaactcaaggtctccctctgtggagggttctttgtgggcagtgggcacagagagc
cagggtcgagattggaggcacctgccgaccctcacacatgagctctctggggctccccgc
ggccacactgtaccctatgctgggagcataggtccccaagagcctggggagccccagggg
ccaccagccagcccttcgtgcccagaggaggccttggctgccacaagggagcagccatgg
gcttcagaggtattcaggcctgagagaatgcccccttctggagctgctcgaagcttccaa
gaagtaatagagccagctatagtggcagtggaccggcaggctgtcttcccagatacctgg
actctcacggaggaacgtggcctacagcaggagaggccaaggccagagccagggaggctg
ggaagcagctcccctgcctcagttaccatggagcagctaggtgcaaagatgactgagagg
ggaagtgtggccaggccaacccagggacctgaaaccccagggagcccagagggcaccacc
gaagctgccacccaggccgggaaggaacagccagagcttccatgtgccatggccacgagc
acacccagcaccatggagaggatttccacctctggccagatccgatctgtgatcaggagg
agccgggagacgggccacgcacaccccatgtcccgggagccctcccctcgccgccggctg
gaccctgccaccctgagcaggaccccatcccaggagcagctcatcgcggagctgcagggg
cggctaggcatccagcctgaggcagaggagctggcggaggcagcggggccctctgcccag
gactggctgaccgagggcatcgtcatcaccgtgcagccacgtgggaagcgggccgggggg
cagcttgtagagaaggttgtcttccctcctggctctcccattcccctgagaagaaccatc
tctgtcctggcttctccttctgtccctttgctccagcatcgcacagacgccgcggccagc
agctcttctcccctgcccagcctgcccacctcctcccctctggggccctcagcttacacc
tgtggttcttctggggtccagagtccaggggaagagccccatgatgagggggtgcagggc
cccaccctttccactcctgcaccccacaccatgaggtccgtgggctgccagaccgatgag
gacccgctcttccccccgatgcagatccagggcctggagcaaagagcggatggggagcgg
tgctgggcggctggctggcctcgggacagcgggcgaagcagccccggagggcaggacgag
ggagggttcatggcccaggggaagacagggagcagctccccccctggggggcccccgaag
cccgggagccagctagacagcatgctggggagcctgcagtccgacctcaacaagctgggg
gtcgccacggtcgccaaaggagtctgcggggcctgcaagaagcccatcgccgggcaggtt
gtgaccgccatggggaagacgtggcaccccgagcacttcgtctgcacccactgccaggag
gagatcggatcccggaacttcttcgagcgggatggacagccctactgtgaaaaggactac
cacaacctcttctccccgcgctgctactactgcaacggccccatcctggataaagtggtg
acagcccttgaccggacgtggcaccctgaacacttcttctgtgcccagtgtggagccttc
ttcggtcctgaagggttccacgagaaggacggcaaggcctactgccgcaaggactacttc
gacatgttcgcaccaaagtgtggcggctgcgcccgggccatcctggagaactatatctcg
gccctcaacacgctgtggcatcctgagtgctttgtgtgccgggaatgcttcacgccattc
gtcaacggcagcttcttcgagcacgacgggcagccctactgtgaggtgcactaccacgag
cggcgcggctcgctgtgctccggctgccagaagcccatcactggccgctgcatcactgcc
atggccaagaagttccaccccgagcacttcgtctgtgccttctgcctcaagcagctcaac
aagggcaccttcaaggagcagaacgacaagccttactgtcagaactgcttcctcaagctc
ttctgctag

DBGET integrated database retrieval system