KEGG   Macaca mulatta (rhesus monkey): 696350
Entry
696350            CDS       T01028                                 

Gene name
CREB3
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04022  cGMP-PKG signaling pathway
mcc04024  cAMP signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04152  AMPK signaling pathway
mcc04211  Longevity regulating pathway
mcc04261  Adrenergic signaling in cardiomyocytes
mcc04668  TNF signaling pathway
mcc04714  Thermogenesis
mcc04725  Cholinergic synapse
mcc04728  Dopaminergic synapse
mcc04911  Insulin secretion
mcc04915  Estrogen signaling pathway
mcc04916  Melanogenesis
mcc04918  Thyroid hormone synthesis
mcc04922  Glucagon signaling pathway
mcc04925  Aldosterone synthesis and secretion
mcc04926  Relaxin signaling pathway
mcc04927  Cortisol synthesis and secretion
mcc04928  Parathyroid hormone synthesis, secretion and action
mcc04931  Insulin resistance
mcc04934  Cushing syndrome
mcc04935  Growth hormone synthesis, secretion and action
mcc04962  Vasopressin-regulated water reabsorption
mcc05016  Huntington disease
mcc05020  Prion disease
mcc05030  Cocaine addiction
mcc05031  Amphetamine addiction
mcc05034  Alcoholism
mcc05161  Hepatitis B
mcc05163  Human cytomegalovirus infection
mcc05165  Human papillomavirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05203  Viral carcinogenesis
mcc05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    696350 (CREB3)
   04024 cAMP signaling pathway
    696350 (CREB3)
   04022 cGMP-PKG signaling pathway
    696350 (CREB3)
   04151 PI3K-Akt signaling pathway
    696350 (CREB3)
   04152 AMPK signaling pathway
    696350 (CREB3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    696350 (CREB3)
   04922 Glucagon signaling pathway
    696350 (CREB3)
   04915 Estrogen signaling pathway
    696350 (CREB3)
   04926 Relaxin signaling pathway
    696350 (CREB3)
   04935 Growth hormone synthesis, secretion and action
    696350 (CREB3)
   04918 Thyroid hormone synthesis
    696350 (CREB3)
   04928 Parathyroid hormone synthesis, secretion and action
    696350 (CREB3)
   04916 Melanogenesis
    696350 (CREB3)
   04925 Aldosterone synthesis and secretion
    696350 (CREB3)
   04927 Cortisol synthesis and secretion
    696350 (CREB3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    696350 (CREB3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    696350 (CREB3)
  09156 Nervous system
   04725 Cholinergic synapse
    696350 (CREB3)
   04728 Dopaminergic synapse
    696350 (CREB3)
  09149 Aging
   04211 Longevity regulating pathway
    696350 (CREB3)
  09159 Environmental adaptation
   04714 Thermogenesis
    696350 (CREB3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    696350 (CREB3)
  09162 Cancer: specific types
   05215 Prostate cancer
    696350 (CREB3)
  09164 Neurodegenerative disease
   05016 Huntington disease
    696350 (CREB3)
   05020 Prion disease
    696350 (CREB3)
  09165 Substance dependence
   05030 Cocaine addiction
    696350 (CREB3)
   05031 Amphetamine addiction
    696350 (CREB3)
   05034 Alcoholism
    696350 (CREB3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    696350 (CREB3)
   04934 Cushing syndrome
    696350 (CREB3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    696350 (CREB3)
   05161 Hepatitis B
    696350 (CREB3)
   05163 Human cytomegalovirus infection
    696350 (CREB3)
   05165 Human papillomavirus infection
    696350 (CREB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcc03000]
    696350 (CREB3)
Transcription factors [BR:mcc03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    696350 (CREB3)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf
Other DBs
NCBI-GeneID: 696350
NCBI-ProteinID: NP_001252576
Ensembl: ENSMMUG00000016328
UniProt: G7NFD1 A0A5F7ZDL7
LinkDB
Position
15
AA seq 372 aa
MELELDAGDQDLLGFLLEESGDLRTAPDESVRAPLDWELPLSEVPSDWEVDDLLSSLLSP
PASSLNVLSNSNPCLVHHDHTYSLPREPVSMDLESESCRKEGTQMTPQHMEELAEQDIVR
LVLTDEEKSLLEKEGLILPETLPLTKMEEQILKRVRRKIRNKRSAQESRRKKKVYVGGLE
SRVLKYTAQNMELQNKVQLLEEQNLSLLHQLRKLQAMVIEISNKTSSSSTCILVLLVSFC
LLLVPAMYSSDTRGSLPAEHGVLSRQLRALPSENPYQLELPALQSEVPKDCTHQWLDSSD
HVLQAPGNSSCLLYYMPQAPSAEPPLEWPFPDLFSEPLCRGPILPLQANLTRKGGWLPTG
SPSVILQDRYSG
NT seq 1119 nt   +upstreamnt  +downstreamnt
atggagctggaattggacgctggtgaccaagacctactgggcttcctgctagaggaaagt
ggagatttgaggacggcgcccgatgagtccgtgagggccccactggactgggagctgccg
ctttctgaggtaccgagcgactgggaggtagatgatttgctgagctccctgctgagtccc
ccagcgtcgtcgttgaacgttctcagcaactccaacccctgccttgtccaccatgaccac
acctactccctcccacgagaacctgtctctatggatctagagagtgagagctgtagaaaa
gaggggacccagatgactccacagcatatggaggagctggcagagcaggatattgttagg
ctggtactgacagatgaggagaagagtctattggagaaggaggggcttattctgcctgag
acacttcctctcactaagatggaggaacaaattctgaaacgtgtgcggaggaagattcga
aataaaagatctgctcaagagagccgcaggaaaaagaaggtgtatgttgggggtttagag
agcagggtcttgaaatacacagcccagaatatggagcttcagaacaaagtacagcttctg
gaggaacagaatttgtcccttctacatcaactgaggaaactccaggccatggtgattgag
atatcaaacaaaacgagcagtagcagcacctgcatcttggtcctactagtctccttctgc
ctcctccttgtacctgctatgtactcctctgacacaagggggagcctgccagctgagcat
ggagtgttgtcccgccagcttcgtgccctccccagtgagaacccttaccagctggagttg
cctgccctgcagtcagaggtgccaaaagactgcacacaccagtggctggacagctcagac
cacgtactccaggcccctggcaactcttcctgcctactgtactacatgcctcaggctccc
agtgcagagcctcccctggagtggccattccctgacctcttctcagagcctctctgccga
ggtcccatcctccccctgcaggcaaatctcacaaggaaggggggatggcttcctaccggt
agcccctctgtcatcttgcaggacagatactcaggctag

KEGG   Macaca mulatta (rhesus monkey): 697718
Entry
697718            CDS       T01028                                 

Gene name
CREB5
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 5 isoform X1
  KO
K09047  cyclic AMP-responsive element-binding protein 5
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04022  cGMP-PKG signaling pathway
mcc04024  cAMP signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04152  AMPK signaling pathway
mcc04211  Longevity regulating pathway
mcc04261  Adrenergic signaling in cardiomyocytes
mcc04668  TNF signaling pathway
mcc04714  Thermogenesis
mcc04725  Cholinergic synapse
mcc04728  Dopaminergic synapse
mcc04911  Insulin secretion
mcc04915  Estrogen signaling pathway
mcc04918  Thyroid hormone synthesis
mcc04922  Glucagon signaling pathway
mcc04925  Aldosterone synthesis and secretion
mcc04926  Relaxin signaling pathway
mcc04927  Cortisol synthesis and secretion
mcc04928  Parathyroid hormone synthesis, secretion and action
mcc04931  Insulin resistance
mcc04934  Cushing syndrome
mcc04935  Growth hormone synthesis, secretion and action
mcc04962  Vasopressin-regulated water reabsorption
mcc05016  Huntington disease
mcc05020  Prion disease
mcc05030  Cocaine addiction
mcc05031  Amphetamine addiction
mcc05034  Alcoholism
mcc05161  Hepatitis B
mcc05163  Human cytomegalovirus infection
mcc05165  Human papillomavirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05203  Viral carcinogenesis
mcc05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    697718 (CREB5)
   04024 cAMP signaling pathway
    697718 (CREB5)
   04022 cGMP-PKG signaling pathway
    697718 (CREB5)
   04151 PI3K-Akt signaling pathway
    697718 (CREB5)
   04152 AMPK signaling pathway
    697718 (CREB5)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    697718 (CREB5)
   04922 Glucagon signaling pathway
    697718 (CREB5)
   04915 Estrogen signaling pathway
    697718 (CREB5)
   04926 Relaxin signaling pathway
    697718 (CREB5)
   04935 Growth hormone synthesis, secretion and action
    697718 (CREB5)
   04918 Thyroid hormone synthesis
    697718 (CREB5)
   04928 Parathyroid hormone synthesis, secretion and action
    697718 (CREB5)
   04925 Aldosterone synthesis and secretion
    697718 (CREB5)
   04927 Cortisol synthesis and secretion
    697718 (CREB5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    697718 (CREB5)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    697718 (CREB5)
  09156 Nervous system
   04725 Cholinergic synapse
    697718 (CREB5)
   04728 Dopaminergic synapse
    697718 (CREB5)
  09149 Aging
   04211 Longevity regulating pathway
    697718 (CREB5)
  09159 Environmental adaptation
   04714 Thermogenesis
    697718 (CREB5)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    697718 (CREB5)
  09162 Cancer: specific types
   05215 Prostate cancer
    697718 (CREB5)
  09164 Neurodegenerative disease
   05016 Huntington disease
    697718 (CREB5)
   05020 Prion disease
    697718 (CREB5)
  09165 Substance dependence
   05030 Cocaine addiction
    697718 (CREB5)
   05031 Amphetamine addiction
    697718 (CREB5)
   05034 Alcoholism
    697718 (CREB5)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    697718 (CREB5)
   04934 Cushing syndrome
    697718 (CREB5)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    697718 (CREB5)
   05161 Hepatitis B
    697718 (CREB5)
   05163 Human cytomegalovirus infection
    697718 (CREB5)
   05165 Human papillomavirus infection
    697718 (CREB5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcc03000]
    697718 (CREB5)
Transcription factors [BR:mcc03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    697718 (CREB5)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB TolA_bind_tri NDUFB11 DivIC
Other DBs
NCBI-GeneID: 697718
NCBI-ProteinID: XP_014989308
Ensembl: ENSMMUG00000039317
UniProt: A0A1D5RAD6
LinkDB
Position
3
AA seq 501 aa
MNLEQERPFVCSAPGCSQRFPTEDHLMIHRHKHEMTLKFPSIKTDNMLSDQTPTPTRFLK
NCEEVGLFSELDCSLEHEFRKAQEEESSKRNISMHNAVGGAMTGPGTHQLSSARLPNHDT
SVVIQQAMPSPQSSSVITQAPSTNRQIGPVPGSLSSLLHLHNRQRQPMPASMPGTLPNPT
MPGSSAVLMPMERQMSVNSSIMGMQGPNLSNPCASPQVQPMHSEAKMRLKAALTHHPAAM
SNGNMNTMGHMMEMMGSRQDQTPHHHMHSHPHQHQTLPPHHPYPHQHQHPAHHPHPQPHH
QQNHPHHHSHSHLHAHPAHHQTSPHPPLHTGNQAQVSPATQQMQPTQTIQPPQPTGGRRR
RVVDEDPDERRRKFLERNRAAATRCRQKRKVWVMSLEKKAEELTQTNMQLQNEVSMLKNE
VAQLKQLLLTHKDCPITAMQKESQGYLSPESSPPASPVPACSQQQVIQHNTITTSSSVSE
VVGSSTLSQLTTHRTDLNPIL
NT seq 1506 nt   +upstreamnt  +downstreamnt
atgaatttggagcaggagaggccgtttgtctgcagtgccccaggctgctcccagcgcttc
ccaacagaggaccatctgatgattcataggcacaaacatgaaatgactttgaagtttcct
tcaataaaaacagacaatatgttatcagatcaaactccaaccccaacgagattcctgaag
aactgcgaagaggtgggcctcttcagcgagctcgactgctccctggagcatgagttcagg
aaggcccaggaggaggagagcagcaagcggaatatctcaatgcataatgcagttggtggg
gccatgacagggcccggaactcaccagcttagcagtgctcgtctgcccaaccacgacacc
agcgttgtgattcagcaagccatgccgtcaccccagtccagctccgtcatcacccaggca
ccttccaccaaccgccagattgggcctgtcccaggctctctatcttctctgctacatctc
cacaacagacagagacagcccatgccagcctccatgcctgggaccctgcccaaccccaca
atgccaggatcttccgccgtcttgatgccaatggagagacaaatgtcagtgaactccagc
atcatggggatgcaaggtccaaatctcagcaacccctgtgcttctccccaggtccagcca
atgcattcagaagccaaaatgaggttgaaggctgcactgactcaccaccctgctgccatg
tcaaatgggaacatgaacaccatgggacacatgatggagatgatgggctcccggcaggac
cagacgccacaccatcacatgcactcgcacccacatcagcaccagacactgccaccccac
cacccttacccacaccagcaccagcacccagcgcaccatcctcaccctcaaccccatcac
cagcagaaccatccacatcaccactcccattctcaccttcatgcacacccagcacatcac
cagacctcgccacatccgcccctgcacaccggcaaccaagcacaggtttcaccagcaaca
caacagatgcagccaacccagacaatacagccaccccagcccacaggggggcgccggcga
agggtggtggacgaggatcccgacgagaggcggcggaaatttctggaacggaaccgggca
gctgccacccgctgcagacagaagaggaaggtctgggtgatgtcattggaaaagaaagca
gaagaactcacccagacaaacatgcagcttcagaatgaagtgtctatgttgaaaaatgag
gtggcccagctgaaacagttgttgttaacacataaagactgcccaataacagccatgcag
aaagaatcacaaggatatctaagtccggagagtagccctcctgctagtcctgtcccagct
tgctcccagcaacaagtcatccagcataataccatcactacttcttcatcagtcagcgag
gtggtaggaagctccaccctcagccagctcaccactcacagaacagacctgaatccaatt
ctttaa

KEGG   Macaca mulatta (rhesus monkey): 699072
Entry
699072            CDS       T01028                                 

Gene name
ATF2
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-2 isoform X1
  KO
K04450  cyclic AMP-dependent transcription factor ATF-2
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04010  MAPK signaling pathway
mcc04022  cGMP-PKG signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04211  Longevity regulating pathway
mcc04261  Adrenergic signaling in cardiomyocytes
mcc04668  TNF signaling pathway
mcc04714  Thermogenesis
mcc04728  Dopaminergic synapse
mcc04911  Insulin secretion
mcc04915  Estrogen signaling pathway
mcc04918  Thyroid hormone synthesis
mcc04922  Glucagon signaling pathway
mcc04925  Aldosterone synthesis and secretion
mcc04926  Relaxin signaling pathway
mcc04927  Cortisol synthesis and secretion
mcc04928  Parathyroid hormone synthesis, secretion and action
mcc04934  Cushing syndrome
mcc04935  Growth hormone synthesis, secretion and action
mcc05020  Prion disease
mcc05030  Cocaine addiction
mcc05031  Amphetamine addiction
mcc05034  Alcoholism
mcc05161  Hepatitis B
mcc05163  Human cytomegalovirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    699072 (ATF2)
   04668 TNF signaling pathway
    699072 (ATF2)
   04022 cGMP-PKG signaling pathway
    699072 (ATF2)
   04151 PI3K-Akt signaling pathway
    699072 (ATF2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    699072 (ATF2)
   04922 Glucagon signaling pathway
    699072 (ATF2)
   04915 Estrogen signaling pathway
    699072 (ATF2)
   04926 Relaxin signaling pathway
    699072 (ATF2)
   04935 Growth hormone synthesis, secretion and action
    699072 (ATF2)
   04918 Thyroid hormone synthesis
    699072 (ATF2)
   04928 Parathyroid hormone synthesis, secretion and action
    699072 (ATF2)
   04925 Aldosterone synthesis and secretion
    699072 (ATF2)
   04927 Cortisol synthesis and secretion
    699072 (ATF2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    699072 (ATF2)
  09156 Nervous system
   04728 Dopaminergic synapse
    699072 (ATF2)
  09149 Aging
   04211 Longevity regulating pathway
    699072 (ATF2)
  09159 Environmental adaptation
   04714 Thermogenesis
    699072 (ATF2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    699072 (ATF2)
  09164 Neurodegenerative disease
   05020 Prion disease
    699072 (ATF2)
  09165 Substance dependence
   05030 Cocaine addiction
    699072 (ATF2)
   05031 Amphetamine addiction
    699072 (ATF2)
   05034 Alcoholism
    699072 (ATF2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    699072 (ATF2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    699072 (ATF2)
   05161 Hepatitis B
    699072 (ATF2)
   05163 Human cytomegalovirus infection
    699072 (ATF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcc03000]
    699072 (ATF2)
Transcription factors [BR:mcc03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    699072 (ATF2)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf zf-C2H2 Herpes_UL16
Other DBs
NCBI-GeneID: 699072
NCBI-ProteinID: XP_014965890
Ensembl: ENSMMUG00000003947
UniProt: G7N8C8
LinkDB
Position
12
AA seq 505 aa
MKFKLHVNSARQYKDLWNMSDDKPFLCTAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARN
DSVIVADQTPTPTRFLKNCEEVGLFNELASPFENEFKKASEDDIKKMPLDLSPLATPIIR
SKIEEPSVVETTHQDSPLPHPESTTSDEKEVPLAQTAQPTSAIVRPASLQVPNVLLTSSD
SSVIIQQAVPSPTSSTVITQAPSSNRPIVPVPGPFPLLLHLPNGQTMPVAIPASITSSNV
HVPAAVPLVRPVTMVPSVPGIPGPSSPQPVQSEAKMRLKAALTQQHPPVTNGDTVKGHGS
GLVRTQSEESRPQSLQQPATSTTETPASPAHTTPQTQSTSGRRRRAANEDPDEKRRKFLE
RNRAAASRCRQKRKVWVQSLEKKAEDLSSLNGQLQSEVTLLRNEVAQLKQLLLAHKDCPV
TAMQKKSGYHTADKDDSSEDISVPSSPHTEAIQHSSVSTSNGVSSTSKAEAVATSVLTQM
ADQSTEPALSQIVMAPSSQSQPSGS
NT seq 1518 nt   +upstreamnt  +downstreamnt
atgaaattcaagttacatgtgaattctgccaggcaatacaaggacctgtggaatatgagt
gatgacaaaccctttctatgcactgcgcctggatgtggccagcgttttaccaacgaggat
catttggctgtccataaacataaacatgagatgacactgaaatttggtccagcacgtaat
gacagtgtcattgtggctgatcagaccccaacaccaacaagattcttgaaaaactgtgaa
gaagtgggtttgtttaatgagttggcaagtccatttgagaatgaattcaagaaagcttca
gaagacgacattaaaaaaatgcctctagatttatcccctcttgcaacacctatcataaga
agcaaaattgaggaaccttctgttgtagaaacaactcaccaggatagtcctttacctcac
ccagagtctactaccagtgatgaaaaggaagtaccattggcacaaacggcacagcccaca
tcagctattgttcgtccagcatcattacaggttcccaatgtgctgcttacaagttctgac
tcaagtgtaattattcagcaggcagtaccttcaccaacctcaagtaccgtaatcacccag
gcaccatcctctaacaggccaattgtccctgtaccaggcccatttcctcttctgttacat
cttcctaatggacaaaccatgcctgttgctattcctgcatcaattacaagttctaatgtg
catgttccagctgcagtcccactcgttcgaccagtcaccatggtgcctagtgttccagga
atcccgggtccttcctctccccaacctgtacagtcggaagcaaaaatgagattaaaagct
gctttgacccagcaacatcctccagttaccaatggtgatactgtcaaaggtcatggtagt
ggattggttaggactcagtcagaggaatctcgaccacagtcattacaacagccagccaca
tccactacagagactccggcttctccagctcacacaactccacagacccaaagtacaagt
ggtcgtcggagaagagcagctaacgaagatcctgatgaaaaaaggagaaagtttttagag
cgaaatagagcagccgcttcaagatgccgacaaaaaaggaaagtctgggttcagtcttta
gagaagaaagcagaagacttgagttcattaaatggtcagctgcagagtgaagtcaccctg
ctgagaaatgaagtggcacagctgaaacagcttcttctggctcataaagattgccctgta
accgccatgcagaagaaatctggctatcatactgctgataaagatgatagttcagaagac
atttcagtgccgagtagtccacatacagaagctatacagcatagttcggtcagcacatct
aatggagtcagttcaacctccaaggcagaagctgtagccacttcagtcctcacccagatg
gcggaccagagtacagagcctgctctttcacagatcgttatggctccttcctcccagtca
cagccctcaggaagttga

KEGG   Macaca mulatta (rhesus monkey): 703965
Entry
703965            CDS       T01028                                 

Gene name
ATF4
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-4
  KO
K04374  cyclic AMP-dependent transcription factor ATF-4
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04010  MAPK signaling pathway
mcc04022  cGMP-PKG signaling pathway
mcc04137  Mitophagy - animal
mcc04141  Protein processing in endoplasmic reticulum
mcc04151  PI3K-Akt signaling pathway
mcc04210  Apoptosis
mcc04211  Longevity regulating pathway
mcc04261  Adrenergic signaling in cardiomyocytes
mcc04668  TNF signaling pathway
mcc04720  Long-term potentiation
mcc04722  Neurotrophin signaling pathway
mcc04725  Cholinergic synapse
mcc04728  Dopaminergic synapse
mcc04911  Insulin secretion
mcc04912  GnRH signaling pathway
mcc04915  Estrogen signaling pathway
mcc04918  Thyroid hormone synthesis
mcc04922  Glucagon signaling pathway
mcc04925  Aldosterone synthesis and secretion
mcc04926  Relaxin signaling pathway
mcc04927  Cortisol synthesis and secretion
mcc04928  Parathyroid hormone synthesis, secretion and action
mcc04932  Non-alcoholic fatty liver disease
mcc04934  Cushing syndrome
mcc04935  Growth hormone synthesis, secretion and action
mcc05010  Alzheimer disease
mcc05012  Parkinson disease
mcc05014  Amyotrophic lateral sclerosis
mcc05020  Prion disease
mcc05022  Pathways of neurodegeneration - multiple diseases
mcc05030  Cocaine addiction
mcc05031  Amphetamine addiction
mcc05034  Alcoholism
mcc05161  Hepatitis B
mcc05163  Human cytomegalovirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05203  Viral carcinogenesis
mcc05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    703965 (ATF4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    703965 (ATF4)
   04668 TNF signaling pathway
    703965 (ATF4)
   04022 cGMP-PKG signaling pathway
    703965 (ATF4)
   04151 PI3K-Akt signaling pathway
    703965 (ATF4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    703965 (ATF4)
  09143 Cell growth and death
   04210 Apoptosis
    703965 (ATF4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    703965 (ATF4)
   04922 Glucagon signaling pathway
    703965 (ATF4)
   04912 GnRH signaling pathway
    703965 (ATF4)
   04915 Estrogen signaling pathway
    703965 (ATF4)
   04926 Relaxin signaling pathway
    703965 (ATF4)
   04935 Growth hormone synthesis, secretion and action
    703965 (ATF4)
   04918 Thyroid hormone synthesis
    703965 (ATF4)
   04928 Parathyroid hormone synthesis, secretion and action
    703965 (ATF4)
   04925 Aldosterone synthesis and secretion
    703965 (ATF4)
   04927 Cortisol synthesis and secretion
    703965 (ATF4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    703965 (ATF4)
  09156 Nervous system
   04725 Cholinergic synapse
    703965 (ATF4)
   04728 Dopaminergic synapse
    703965 (ATF4)
   04720 Long-term potentiation
    703965 (ATF4)
   04722 Neurotrophin signaling pathway
    703965 (ATF4)
  09149 Aging
   04211 Longevity regulating pathway
    703965 (ATF4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    703965 (ATF4)
  09162 Cancer: specific types
   05215 Prostate cancer
    703965 (ATF4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    703965 (ATF4)
   05012 Parkinson disease
    703965 (ATF4)
   05014 Amyotrophic lateral sclerosis
    703965 (ATF4)
   05020 Prion disease
    703965 (ATF4)
   05022 Pathways of neurodegeneration - multiple diseases
    703965 (ATF4)
  09165 Substance dependence
   05030 Cocaine addiction
    703965 (ATF4)
   05031 Amphetamine addiction
    703965 (ATF4)
   05034 Alcoholism
    703965 (ATF4)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    703965 (ATF4)
   04934 Cushing syndrome
    703965 (ATF4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    703965 (ATF4)
   05161 Hepatitis B
    703965 (ATF4)
   05163 Human cytomegalovirus infection
    703965 (ATF4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcc03000]
    703965 (ATF4)
Transcription factors [BR:mcc03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    703965 (ATF4)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 DUF3450 AAA_13 DUF4407 Nop53 Laminin_II Fez1 bZIP_Maf
Other DBs
NCBI-GeneID: 703965
NCBI-ProteinID: NP_001253561
UniProt: F7GFP2
LinkDB
Position
10
AA seq 351 aa
MTEMSFLSSEVLVGDLMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAKAGSSE
WLAVDGLVSPSNNGKEDAFSGTDWMLEKMDLKEFDFDALLGIDDLETMPDDLLTTLDDTC
DLFAPLVQETNKEPPQTVNPIGHLPESLTKPDQVAPFTFLQPLPLSPGVLSSTPDHSFSL
ELGSEVDITEGDRKPDATAYVAMIPPCIKEEDTPSDNDSGICMSPESYLGSPQHSPSTRG
SPNRSLPSPGVLCGSARPKPYDPPGEKMVEAKVKGEKLDKKLKKMEQNKTAATRYRQKKR
AEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRVP
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgaccgaaatgagcttcctgagcagcgaggtgttggtgggggacttgatgtcccccttc
gaccagtcgggtttgggggctgaagaaagcctaggtctcttagatgactacctggaggtg
gccaagcacttcaaacctcatgggttctccagcgacaaggctaaggcgggctcctccgaa
tggctggctgtggatgggttggtcagtccctccaacaacggcaaggaggatgccttctcc
gggacagattggatgttggagaaaatggatttgaaggagttcgactttgatgccctgttg
ggtatagatgacctggaaaccatgccagatgaccttttgaccacgttggatgacacgtgt
gatctctttgcccccctagtccaggagactaacaaggagcccccacagacggtgaaccca
attggccatctcccagaaagtttaacaaaacccgaccaggttgcccccttcaccttcttg
caacctcttcccctttccccaggggtcctgtcctccactccagatcattcctttagttta
gagctgggcagtgaagtggatatcactgaaggagataggaagccagatgccactgcttat
gttgccatgatccctccgtgcataaaggaggaagacaccccctcagataatgatagtggc
atctgtatgagcccggagtcctatctgggctctcctcagcatagcccgtctaccaggggc
tctccaaataggagcctcccatctccaggtgttctctgtggctctgcccgccccaaacct
tacgaccctcctggagagaagatggtagaagcaaaagtaaagggtgagaaactggataag
aagctgaaaaaaatggagcaaaacaagacagcagccactaggtaccgccagaagaagagg
gcggagcaggaggccctcactggcgagtgcaaagagctggaaaagaagaatgaggcttta
aaagagagggcggattccctggccaaggagatccagtacctgaaagatttgatagaagag
gtccgcaaggcaagggggaagaaaagggtcccctag

KEGG   Macaca mulatta (rhesus monkey): 708717
Entry
708717            CDS       T01028                                 

Gene name
CREB1
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 1
  KO
K05870  cyclic AMP-responsive element-binding protein 1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04022  cGMP-PKG signaling pathway
mcc04024  cAMP signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04152  AMPK signaling pathway
mcc04211  Longevity regulating pathway
mcc04261  Adrenergic signaling in cardiomyocytes
mcc04380  Osteoclast differentiation
mcc04612  Antigen processing and presentation
mcc04668  TNF signaling pathway
mcc04710  Circadian rhythm
mcc04713  Circadian entrainment
mcc04714  Thermogenesis
mcc04725  Cholinergic synapse
mcc04728  Dopaminergic synapse
mcc04911  Insulin secretion
mcc04915  Estrogen signaling pathway
mcc04916  Melanogenesis
mcc04918  Thyroid hormone synthesis
mcc04922  Glucagon signaling pathway
mcc04924  Renin secretion
mcc04925  Aldosterone synthesis and secretion
mcc04926  Relaxin signaling pathway
mcc04927  Cortisol synthesis and secretion
mcc04928  Parathyroid hormone synthesis, secretion and action
mcc04931  Insulin resistance
mcc04934  Cushing syndrome
mcc04935  Growth hormone synthesis, secretion and action
mcc04962  Vasopressin-regulated water reabsorption
mcc05016  Huntington disease
mcc05020  Prion disease
mcc05030  Cocaine addiction
mcc05031  Amphetamine addiction
mcc05034  Alcoholism
mcc05152  Tuberculosis
mcc05161  Hepatitis B
mcc05163  Human cytomegalovirus infection
mcc05165  Human papillomavirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05203  Viral carcinogenesis
mcc05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    708717 (CREB1)
   04024 cAMP signaling pathway
    708717 (CREB1)
   04022 cGMP-PKG signaling pathway
    708717 (CREB1)
   04151 PI3K-Akt signaling pathway
    708717 (CREB1)
   04152 AMPK signaling pathway
    708717 (CREB1)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    708717 (CREB1)
  09152 Endocrine system
   04911 Insulin secretion
    708717 (CREB1)
   04922 Glucagon signaling pathway
    708717 (CREB1)
   04915 Estrogen signaling pathway
    708717 (CREB1)
   04926 Relaxin signaling pathway
    708717 (CREB1)
   04935 Growth hormone synthesis, secretion and action
    708717 (CREB1)
   04918 Thyroid hormone synthesis
    708717 (CREB1)
   04928 Parathyroid hormone synthesis, secretion and action
    708717 (CREB1)
   04916 Melanogenesis
    708717 (CREB1)
   04924 Renin secretion
    708717 (CREB1)
   04925 Aldosterone synthesis and secretion
    708717 (CREB1)
   04927 Cortisol synthesis and secretion
    708717 (CREB1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    708717 (CREB1)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    708717 (CREB1)
  09156 Nervous system
   04725 Cholinergic synapse
    708717 (CREB1)
   04728 Dopaminergic synapse
    708717 (CREB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    708717 (CREB1)
  09149 Aging
   04211 Longevity regulating pathway
    708717 (CREB1)
  09159 Environmental adaptation
   04710 Circadian rhythm
    708717 (CREB1)
   04713 Circadian entrainment
    708717 (CREB1)
   04714 Thermogenesis
    708717 (CREB1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    708717 (CREB1)
  09162 Cancer: specific types
   05215 Prostate cancer
    708717 (CREB1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    708717 (CREB1)
   05020 Prion disease
    708717 (CREB1)
  09165 Substance dependence
   05030 Cocaine addiction
    708717 (CREB1)
   05031 Amphetamine addiction
    708717 (CREB1)
   05034 Alcoholism
    708717 (CREB1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    708717 (CREB1)
   04934 Cushing syndrome
    708717 (CREB1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    708717 (CREB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    708717 (CREB1)
   05161 Hepatitis B
    708717 (CREB1)
   05163 Human cytomegalovirus infection
    708717 (CREB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    708717 (CREB1)
   05165 Human papillomavirus infection
    708717 (CREB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcc03000]
    708717 (CREB1)
   03029 Mitochondrial biogenesis [BR:mcc03029]
    708717 (CREB1)
Transcription factors [BR:mcc03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    708717 (CREB1)
Mitochondrial biogenesis [BR:mcc03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    708717 (CREB1)
SSDB
Motif
Pfam: pKID bZIP_1 bZIP_2 bZIP_Maf
Other DBs
NCBI-GeneID: 708717
NCBI-ProteinID: NP_001248049
Ensembl: ENSMMUG00000022601
UniProt: F7AUB4 G7N8R8
LinkDB
Position
12
AA seq 341 aa
MTMESGAENQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPN
GQTVQVHGVIQAAQPSVIQSPQVQTVQSSCKDLKRLFSGTQISTIAESEDSQESVDSVTD
SQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSG
QYIAITQGGAIQLANNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQV
VVQAASGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAAREC
RRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKSD
NT seq 1026 nt   +upstreamnt  +downstreamnt
atgaccatggaatctggagccgagaaccagcagagtggagatgcagctgtaacagaagct
gaaaaccaacaaatgacagttcaagcccagccacagattgccacattagcccaggtatct
atgccagcagctcatgcaacatcttctgctccaactgtaactctagtacagctgcccaat
gggcagacagttcaagtccatggagtcattcaggcggcccagccatcagttattcagtct
ccacaagtccaaacagttcagtcttcctgtaaggacttaaaaagacttttctccggaaca
cagatttcaactattgcagaaagtgaagattcacaggagtcagtggatagtgtaactgat
tcccaaaagcgaagggaaattctttcaaggaggccttcttacaggaaaattttgaatgac
ttatcttctgatgcaccaggagtgccaagaattgaagaagagaagtcggaagaggagacc
tcagcacctgccatcaccactgtaacggtgccaactccaatttaccaaactagcagtgga
cagtatattgccattacccagggaggagcaatacaactggctaacaatggtaccgatggg
gtacagggcctgcaaacattaaccatgaccaatgcagccgccactcagccgggtactacc
attctacagtatgcacagaccactgatggacagcagatcttagtgcccagcaaccaagtt
gttgttcaagctgcctctggagatgtacagacataccagattcgcacagcacccactagc
actattgcccctggagttgttatggcatcctccccagcacttcctacacagcctgctgaa
gaagcagcacgaaagagagaggttcgtctaatgaagaacagggaagcagctcgagagtgt
cgtagaaagaagaaagaatatgtgaaatgtttagaaaacagagtggcagtgcttgaaaat
caaaacaagacattgattgaggagctaaaagcacttaaggacctttactgccacaaatca
gattaa

KEGG   Macaca mulatta (rhesus monkey): 713391
Entry
713391            CDS       T01028                                 

Gene name
CREB3L1
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 1 isoform X1
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04022  cGMP-PKG signaling pathway
mcc04024  cAMP signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04152  AMPK signaling pathway
mcc04211  Longevity regulating pathway
mcc04261  Adrenergic signaling in cardiomyocytes
mcc04668  TNF signaling pathway
mcc04714  Thermogenesis
mcc04725  Cholinergic synapse
mcc04728  Dopaminergic synapse
mcc04911  Insulin secretion
mcc04915  Estrogen signaling pathway
mcc04916  Melanogenesis
mcc04918  Thyroid hormone synthesis
mcc04922  Glucagon signaling pathway
mcc04925  Aldosterone synthesis and secretion
mcc04926  Relaxin signaling pathway
mcc04927  Cortisol synthesis and secretion
mcc04928  Parathyroid hormone synthesis, secretion and action
mcc04931  Insulin resistance
mcc04934  Cushing syndrome
mcc04935  Growth hormone synthesis, secretion and action
mcc04962  Vasopressin-regulated water reabsorption
mcc05016  Huntington disease
mcc05020  Prion disease
mcc05030  Cocaine addiction
mcc05031  Amphetamine addiction
mcc05034  Alcoholism
mcc05161  Hepatitis B
mcc05163  Human cytomegalovirus infection
mcc05165  Human papillomavirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05203  Viral carcinogenesis
mcc05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    713391 (CREB3L1)
   04024 cAMP signaling pathway
    713391 (CREB3L1)
   04022 cGMP-PKG signaling pathway
    713391 (CREB3L1)
   04151 PI3K-Akt signaling pathway
    713391 (CREB3L1)
   04152 AMPK signaling pathway
    713391 (CREB3L1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    713391 (CREB3L1)
   04922 Glucagon signaling pathway
    713391 (CREB3L1)
   04915 Estrogen signaling pathway
    713391 (CREB3L1)
   04926 Relaxin signaling pathway
    713391 (CREB3L1)
   04935 Growth hormone synthesis, secretion and action
    713391 (CREB3L1)
   04918 Thyroid hormone synthesis
    713391 (CREB3L1)
   04928 Parathyroid hormone synthesis, secretion and action
    713391 (CREB3L1)
   04916 Melanogenesis
    713391 (CREB3L1)
   04925 Aldosterone synthesis and secretion
    713391 (CREB3L1)
   04927 Cortisol synthesis and secretion
    713391 (CREB3L1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    713391 (CREB3L1)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    713391 (CREB3L1)
  09156 Nervous system
   04725 Cholinergic synapse
    713391 (CREB3L1)
   04728 Dopaminergic synapse
    713391 (CREB3L1)
  09149 Aging
   04211 Longevity regulating pathway
    713391 (CREB3L1)
  09159 Environmental adaptation
   04714 Thermogenesis
    713391 (CREB3L1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    713391 (CREB3L1)
  09162 Cancer: specific types
   05215 Prostate cancer
    713391 (CREB3L1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    713391 (CREB3L1)
   05020 Prion disease
    713391 (CREB3L1)
  09165 Substance dependence
   05030 Cocaine addiction
    713391 (CREB3L1)
   05031 Amphetamine addiction
    713391 (CREB3L1)
   05034 Alcoholism
    713391 (CREB3L1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    713391 (CREB3L1)
   04934 Cushing syndrome
    713391 (CREB3L1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    713391 (CREB3L1)
   05161 Hepatitis B
    713391 (CREB3L1)
   05163 Human cytomegalovirus infection
    713391 (CREB3L1)
   05165 Human papillomavirus infection
    713391 (CREB3L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcc03000]
    713391 (CREB3L1)
Transcription factors [BR:mcc03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    713391 (CREB3L1)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf LMBR1 ELP6 Jnk-SapK_ap_N Prominin TPR_MLP1_2 APG6_N HAUS-augmin3 JMY RNase_Y_N DUF4404 ADIP DUF724
Other DBs
NCBI-GeneID: 713391
NCBI-ProteinID: XP_014969881
Ensembl: ENSMMUG00000018571
UniProt: G7NDH4 A0A663DBK8
LinkDB
Position
14
AA seq 519 aa
MDAVLEPFPADRLFPGSSFLDLGDLNESDFLNNAHFPEHLDHFTENMEDFSNDLFSSFFD
DPVLDEKSPLLDMELDSPTPGIQAEHSYSLSGDSAPQSPLVPIKMEDTTQDVEHGAWALG
HKLCSIMVKQEQSPELPVDPLAAPSAMSAAAAMATTPLLGLSPLSRLPIPHQAPGEMTQL
PVIKAEPPEVNQFLKVTPEDLVQMPPTPPSSHGSDSDGSQSPRSLPPSSPVRPMARSSTA
ISTSPLLTAPHKLQGTSGPLLLTEEEKRTLIAEGYPIPTKLPLTKAEEKALKRVRRKIKN
KISAQESRRKKKEYVECLEKKVETFTSENNELWKKVETLENANRTLLQQLQKLQTLVTNK
ISRPYKMAATQTGTCLMVAALCFVLVLGSLVPCLPEFSSGSQTVKEDPMAADSIYTASQM
PSRSLLFYDDGAGSWEDGRSALLPMEPPDGWEINPGGPAEQRPQDHLQHDHLDNSHETTK
YLSEAWPKDGGNGTSPDFSHSKEWFHDRDLGPNTTIKLS
NT seq 1560 nt   +upstreamnt  +downstreamnt
atggacgccgtcttggaaccattcccggccgacaggctgttccccggatccagcttcctg
gacttgggggatctgaacgagtcggacttcctcaacaatgcgcactttcctgagcacctg
gaccacttcacggagaacatggaggacttctccaacgacctgttcagcagtttctttgat
gaccctgtgctggatgagaagagccctctattggacatggaactggactcccctacgcca
ggcatccaggcggagcacagctactccctgagcggcgactcagcgccccagagccccctc
gtgcccatcaagatggaggacaccacccaagacgtggagcatggagcgtgggcgctggga
cacaaactgtgctccatcatggtgaagcaggagcagagcccggagctgcctgtggacccc
ctggctgccccctcggccatgtctgccgcggccgccatggccaccaccccgctgctgggc
ctcagcccgttgtccaggctgcccatcccccaccaggccccaggagagatgactcagctg
ccagtgatcaaagcagagcctccggaggtgaaccagttcctcaaagtgacaccggaggac
ctggtgcagatgcctccgacgcctcccagcagccacggcagtgacagcgacggctcccag
agtccccgctctctgcccccctccagccctgtcaggcccatggcacgctcctccacggcc
atctccacctccccactcctgactgcccctcacaaattacaggggacatcagggccactg
ctcctgacagaggaggagaagcggaccctgattgctgagggctaccccatccccacaaaa
ctccccctcaccaaagccgaggagaaagccttaaagagagtccggaggaaaatcaagaac
aagatctcggcccaggagagccgtcgtaagaagaaggagtatgtggagtgtctagaaaag
aaggtggaaacatttacatctgagaacaatgaactgtggaagaaggtagagaccctggag
aatgccaacaggaccctgctccagcagctgcagaaactccagactctggtcaccaacaag
atctccagaccttacaagatggccgccacccagactgggacctgcctcatggtggcagcc
ttgtgctttgttctggtgctgggctccctcgtgccctgccttcccgagttctcctccggc
tcccagactgtgaaggaagaccccatggccgcagacagcatctacacggccagccagatg
ccctcccgaagcctcctattctatgatgacggggcaggctcatgggaagatggccgcagc
gccctgctgcccatggagcccccagatggctgggaaatcaaccccggggggccggcagag
cagcggccccaggaccacctgcagcatgaccacctggacaacagccacgagaccaccaag
tacctgagtgaggcctggcctaaagacggtggaaacggcaccagccccgacttctcccac
tccaaggagtggttccacgacagggatctgggtcctaacaccaccatcaaactctcttag

KEGG   Macaca mulatta (rhesus monkey): 714981
Entry
714981            CDS       T01028                                 

Gene name
CREB3L2
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 2
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04022  cGMP-PKG signaling pathway
mcc04024  cAMP signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04152  AMPK signaling pathway
mcc04211  Longevity regulating pathway
mcc04261  Adrenergic signaling in cardiomyocytes
mcc04668  TNF signaling pathway
mcc04714  Thermogenesis
mcc04725  Cholinergic synapse
mcc04728  Dopaminergic synapse
mcc04911  Insulin secretion
mcc04915  Estrogen signaling pathway
mcc04916  Melanogenesis
mcc04918  Thyroid hormone synthesis
mcc04922  Glucagon signaling pathway
mcc04925  Aldosterone synthesis and secretion
mcc04926  Relaxin signaling pathway
mcc04927  Cortisol synthesis and secretion
mcc04928  Parathyroid hormone synthesis, secretion and action
mcc04931  Insulin resistance
mcc04934  Cushing syndrome
mcc04935  Growth hormone synthesis, secretion and action
mcc04962  Vasopressin-regulated water reabsorption
mcc05016  Huntington disease
mcc05020  Prion disease
mcc05030  Cocaine addiction
mcc05031  Amphetamine addiction
mcc05034  Alcoholism
mcc05161  Hepatitis B
mcc05163  Human cytomegalovirus infection
mcc05165  Human papillomavirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05203  Viral carcinogenesis
mcc05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    714981 (CREB3L2)
   04024 cAMP signaling pathway
    714981 (CREB3L2)
   04022 cGMP-PKG signaling pathway
    714981 (CREB3L2)
   04151 PI3K-Akt signaling pathway
    714981 (CREB3L2)
   04152 AMPK signaling pathway
    714981 (CREB3L2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    714981 (CREB3L2)
   04922 Glucagon signaling pathway
    714981 (CREB3L2)
   04915 Estrogen signaling pathway
    714981 (CREB3L2)
   04926 Relaxin signaling pathway
    714981 (CREB3L2)
   04935 Growth hormone synthesis, secretion and action
    714981 (CREB3L2)
   04918 Thyroid hormone synthesis
    714981 (CREB3L2)
   04928 Parathyroid hormone synthesis, secretion and action
    714981 (CREB3L2)
   04916 Melanogenesis
    714981 (CREB3L2)
   04925 Aldosterone synthesis and secretion
    714981 (CREB3L2)
   04927 Cortisol synthesis and secretion
    714981 (CREB3L2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    714981 (CREB3L2)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    714981 (CREB3L2)
  09156 Nervous system
   04725 Cholinergic synapse
    714981 (CREB3L2)
   04728 Dopaminergic synapse
    714981 (CREB3L2)
  09149 Aging
   04211 Longevity regulating pathway
    714981 (CREB3L2)
  09159 Environmental adaptation
   04714 Thermogenesis
    714981 (CREB3L2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    714981 (CREB3L2)
  09162 Cancer: specific types
   05215 Prostate cancer
    714981 (CREB3L2)
  09164 Neurodegenerative disease
   05016 Huntington disease
    714981 (CREB3L2)
   05020 Prion disease
    714981 (CREB3L2)
  09165 Substance dependence
   05030 Cocaine addiction
    714981 (CREB3L2)
   05031 Amphetamine addiction
    714981 (CREB3L2)
   05034 Alcoholism
    714981 (CREB3L2)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    714981 (CREB3L2)
   04934 Cushing syndrome
    714981 (CREB3L2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    714981 (CREB3L2)
   05161 Hepatitis B
    714981 (CREB3L2)
   05163 Human cytomegalovirus infection
    714981 (CREB3L2)
   05165 Human papillomavirus infection
    714981 (CREB3L2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcc03000]
    714981 (CREB3L2)
Transcription factors [BR:mcc03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    714981 (CREB3L2)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf HAUS6_N JMY HAUS-augmin3
Other DBs
NCBI-GeneID: 714981
NCBI-ProteinID: XP_014990479
Ensembl: ENSMMUG00000016833
UniProt: G7MML9 A0A663DI03
LinkDB
Position
3
AA seq 520 aa
MEVLESGEQGVLQWDRKLSELSEPGDGEALMYHTHFSELLDEFSQNVLGQLLNDPFLSEK
SVSMEVEPSPTSPAPLIQAEHSYSLCEEPRAQSPFTHVTTSDSFNDDEVESEKWYLSTDF
PSTTIKTEPITDEPPPGLVPSVTLTITAISTPYEKEEPPLEMNTGVDSSCQTIIPKIKLE
PHEVDQFLNFSPKEAPVDHLHLPPTPPSSHGSDSEGSLSPNPRLHPFSLPQTHSPSRAAP
RAPSALSSSPLLTAPHKLQGSGPLVLTEEEKRTLIAEGYPIPTKLPLSKSEEKALKKIRR
KIKNKISAQESRRKKKEYMDSLEKKVESCSTENLELRKKVEVLENTNRTLLQQLQKLQTL
VMGKVSRTCKLAGTQTGTCLMVVVLCFAVAFGSFFQGYGPYPSATKMALPSQHSLQEPYT
ASVVRSRNLLIYEEHSPQEELSSPGSAGELGGWDRGSSLLRVSTLESRPDVDLPHFIISN
ETSLEKSVLLELQQHLVSAKLEGNETLKVVELDRRVNTTF
NT seq 1563 nt   +upstreamnt  +downstreamnt
atggaggtgctggagagcggggagcagggcgtgctgcagtgggaccgcaagctgagcgag
ctgtcagagcccggggacggcgaggccctcatgtaccacacgcacttctcagaacttctg
gatgagttttcccagaacgtcttgggtcagctcctgaatgaccctttcctctcagagaag
agtgtgtcaatggaggtggaaccttccccgacgtccccggcgcctctcatccaggctgag
cacagctactccctgtgcgaggagcctcgggcccagtcgcccttcacccacgttaccacc
agtgacagcttcaatgacgatgaggtggaaagtgagaaatggtacctgtctacagacttc
ccttcaacaaccatcaagacagagccaattacagacgaaccacccccaggactcgttccg
tctgtcactctgacgatcacagccatctccaccccgtatgaaaaggaggaacctcctctg
gaaatgaatactggggttgattcctcgtgccagaccattattcctaaaattaagctggag
cctcatgaagtggatcagtttctaaacttctctcctaaagaagccccagtggaccacctg
catttaccgcccacccccccgagcagtcacggcagtgactcagagggcagcctgagtccc
aacccacgcctgcaccccttcagtctgcctcagacccacagcccctccagagctgcaccc
cgggccccctccgccctctccagctcccctcttctcacggctcctcataaactgcaggga
tcaggccctctggtcctgacagaggaggaaaagaggaccctgatcgctgagggctatccc
atccccaccaaattgcccctgtcaaaatcagaggagaaggccctgaagaaaattcggcgg
aagatcaagaataagatttctgcccaagaaagtaggagaaagaagaaagaatacatggac
agcctggagaaaaaagtggagtcttgttcaactgagaacttggagcttcggaagaaggta
gaggttttagagaacactaacaggactctccttcagcaactccagaagcttcagactttg
gtgatgggcaaggtttctcgaacctgcaagttagccggcacgcagactggcacctgcctc
atggttgtggtgctgtgctttgctgttgcattcggcagcttctttcaaggctatgggccc
tatccttctgccaccaagatggctctgcccagccagcattccctgcaggagccctacaca
gcctccgtggtgagatccaggaacctgctgatctatgaggaacattctccccaagaagag
ctgtccagcccaggctcagctggggagctggggggctgggacagaggttcctccctgctc
agggtgtcaacgctggagtccaggccggatgtggatcttccccatttcattatctcgaat
gagaccagcctggagaagtcagtgctcttggagctgcagcagcacctggtcagcgccaaa
ctggagggaaatgaaacactaaaagttgtagaactcgacagaagagtgaacaccactttc
taa

KEGG   Macaca mulatta (rhesus monkey): 715951
Entry
715951            CDS       T01028                                 

Gene name
CREB3L4
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 4
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04022  cGMP-PKG signaling pathway
mcc04024  cAMP signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04152  AMPK signaling pathway
mcc04211  Longevity regulating pathway
mcc04261  Adrenergic signaling in cardiomyocytes
mcc04668  TNF signaling pathway
mcc04714  Thermogenesis
mcc04725  Cholinergic synapse
mcc04728  Dopaminergic synapse
mcc04911  Insulin secretion
mcc04915  Estrogen signaling pathway
mcc04916  Melanogenesis
mcc04918  Thyroid hormone synthesis
mcc04922  Glucagon signaling pathway
mcc04925  Aldosterone synthesis and secretion
mcc04926  Relaxin signaling pathway
mcc04927  Cortisol synthesis and secretion
mcc04928  Parathyroid hormone synthesis, secretion and action
mcc04931  Insulin resistance
mcc04934  Cushing syndrome
mcc04935  Growth hormone synthesis, secretion and action
mcc04962  Vasopressin-regulated water reabsorption
mcc05016  Huntington disease
mcc05020  Prion disease
mcc05030  Cocaine addiction
mcc05031  Amphetamine addiction
mcc05034  Alcoholism
mcc05161  Hepatitis B
mcc05163  Human cytomegalovirus infection
mcc05165  Human papillomavirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05203  Viral carcinogenesis
mcc05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    715951 (CREB3L4)
   04024 cAMP signaling pathway
    715951 (CREB3L4)
   04022 cGMP-PKG signaling pathway
    715951 (CREB3L4)
   04151 PI3K-Akt signaling pathway
    715951 (CREB3L4)
   04152 AMPK signaling pathway
    715951 (CREB3L4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    715951 (CREB3L4)
   04922 Glucagon signaling pathway
    715951 (CREB3L4)
   04915 Estrogen signaling pathway
    715951 (CREB3L4)
   04926 Relaxin signaling pathway
    715951 (CREB3L4)
   04935 Growth hormone synthesis, secretion and action
    715951 (CREB3L4)
   04918 Thyroid hormone synthesis
    715951 (CREB3L4)
   04928 Parathyroid hormone synthesis, secretion and action
    715951 (CREB3L4)
   04916 Melanogenesis
    715951 (CREB3L4)
   04925 Aldosterone synthesis and secretion
    715951 (CREB3L4)
   04927 Cortisol synthesis and secretion
    715951 (CREB3L4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    715951 (CREB3L4)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    715951 (CREB3L4)
  09156 Nervous system
   04725 Cholinergic synapse
    715951 (CREB3L4)
   04728 Dopaminergic synapse
    715951 (CREB3L4)
  09149 Aging
   04211 Longevity regulating pathway
    715951 (CREB3L4)
  09159 Environmental adaptation
   04714 Thermogenesis
    715951 (CREB3L4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    715951 (CREB3L4)
  09162 Cancer: specific types
   05215 Prostate cancer
    715951 (CREB3L4)
  09164 Neurodegenerative disease
   05016 Huntington disease
    715951 (CREB3L4)
   05020 Prion disease
    715951 (CREB3L4)
  09165 Substance dependence
   05030 Cocaine addiction
    715951 (CREB3L4)
   05031 Amphetamine addiction
    715951 (CREB3L4)
   05034 Alcoholism
    715951 (CREB3L4)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    715951 (CREB3L4)
   04934 Cushing syndrome
    715951 (CREB3L4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    715951 (CREB3L4)
   05161 Hepatitis B
    715951 (CREB3L4)
   05163 Human cytomegalovirus infection
    715951 (CREB3L4)
   05165 Human papillomavirus infection
    715951 (CREB3L4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcc03000]
    715951 (CREB3L4)
Transcription factors [BR:mcc03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    715951 (CREB3L4)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB DUF4407 EMP24_GP25L JMY ATG16 OppC_N HAUS-augmin3 HALZ KASH_CCD Jnk-SapK_ap_N DUF1664 MCU YabA UPF0242 DUF4200 DUF724
Other DBs
NCBI-GeneID: 715951
NCBI-ProteinID: NP_001252928
Ensembl: ENSMMUG00000005008
UniProt: F6VJI3 G7MDT0
LinkDB
Position
1
AA seq 395 aa
MDLGIPDLLDAWLEPPEDIFSTGSVLELGLHCPPPEVPVTRLQEQGLQGWKSGGDHGCGL
QESEPEDFLKLFIDPNEVYRSEASPGNDSGTSEDPCRPDSPPAPRATSSPTLYEVVYEAG
ALERMQGETGPTVGLISIQLDQWSPAFMVPDSCMVSELPFDAHAHILPRAGTLAPVPCTT
LLPCQTLFLTDEEKRLLGQEGVSLPSHLPLTKAEERVLKKVRRKIRNKQSAQDSRRRKKE
YIDGLESRVAACSAQNQELQKKVQELERHNISLVAQLRQLQTLIAQTSNKAAQTSTCVLI
LLFSLALIILPSFSPFQGRPEAGPEDYQPHGVTSRNILTHKDITENLETQVVESRLREPP
EAKDANDSTRTLLEKMGGKPRPSGRIGTVLHADEM
NT seq 1188 nt   +upstreamnt  +downstreamnt
atggatctcggtatccctgacctgctggacgcgtggctggagcccccagaggatatcttc
tccacaggatccgtcctggagctgggactccactgcccccctccagaggttccggtgact
aggctacaggaacagggactgcaaggctggaagtccggtggggaccatggctgtggcctt
caagagagtgagcctgaagatttcttgaagcttttcattgatcccaatgaggtgtaccgc
tcagaagcatctcctggcaatgacagtggcacctctgaggacccctgccgtccagacagt
ccccctgcccccagggcaaccagttctcctacgctctatgaagttgtctatgaggcaggg
gccctggagaggatgcagggggaaactgggccaactgtaggcctcatctccatccagcta
gatcagtggagcccagcatttatggtacctgattcctgcatggtcagtgagctgcccttt
gatgctcatgcccacatcttgcccagagcaggcaccttagccccagtgccttgtacaacc
ctgctgccctgtcaaaccctgttcctgacggatgaggagaagcgtctgctggggcaggaa
ggggtttctctgccctctcacctgcccctcaccaaggcagaggagagggtcctcaagaag
gtcaggaggaaaatccgtaacaagcagtcagctcaggacagtcggcggcggaagaaggag
tacattgatgggctggagagcagggtggcagcctgttctgcacagaaccaagaattacag
aaaaaagtccaggagctggagaggcacaatatctccttggtagctcagctccgccagctg
cagacgctaattgctcaaacttccaacaaagccgcccagaccagcacttgtgttctgatt
cttcttttttccctggctctcatcatcctgcccagcttcagtccattccagggtcgacca
gaagctgggcctgaggattaccagcctcacggagtgacttccagaaatatcctgacccac
aaggacataacagaaaatctggagacccaagtggtagagtccagactgagggagccacct
gaagccaaggatgcaaatgactcaacaaggacactgcttgagaagatgggagggaagcca
agacccagtgggcgcatcgggaccgtgctgcatgcagatgagatgtga

KEGG   Macaca mulatta (rhesus monkey): 717050
Entry
717050            CDS       T01028                                 

Gene name
ATF6B
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta isoform X1
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04022  cGMP-PKG signaling pathway
mcc04141  Protein processing in endoplasmic reticulum
mcc04151  PI3K-Akt signaling pathway
mcc04211  Longevity regulating pathway
mcc04261  Adrenergic signaling in cardiomyocytes
mcc04668  TNF signaling pathway
mcc04728  Dopaminergic synapse
mcc04911  Insulin secretion
mcc04915  Estrogen signaling pathway
mcc04918  Thyroid hormone synthesis
mcc04925  Aldosterone synthesis and secretion
mcc04926  Relaxin signaling pathway
mcc04927  Cortisol synthesis and secretion
mcc04928  Parathyroid hormone synthesis, secretion and action
mcc04934  Cushing syndrome
mcc04935  Growth hormone synthesis, secretion and action
mcc05020  Prion disease
mcc05030  Cocaine addiction
mcc05031  Amphetamine addiction
mcc05034  Alcoholism
mcc05161  Hepatitis B
mcc05163  Human cytomegalovirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    717050 (ATF6B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    717050 (ATF6B)
   04022 cGMP-PKG signaling pathway
    717050 (ATF6B)
   04151 PI3K-Akt signaling pathway
    717050 (ATF6B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    717050 (ATF6B)
   04915 Estrogen signaling pathway
    717050 (ATF6B)
   04926 Relaxin signaling pathway
    717050 (ATF6B)
   04935 Growth hormone synthesis, secretion and action
    717050 (ATF6B)
   04918 Thyroid hormone synthesis
    717050 (ATF6B)
   04928 Parathyroid hormone synthesis, secretion and action
    717050 (ATF6B)
   04925 Aldosterone synthesis and secretion
    717050 (ATF6B)
   04927 Cortisol synthesis and secretion
    717050 (ATF6B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    717050 (ATF6B)
  09156 Nervous system
   04728 Dopaminergic synapse
    717050 (ATF6B)
  09149 Aging
   04211 Longevity regulating pathway
    717050 (ATF6B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    717050 (ATF6B)
  09164 Neurodegenerative disease
   05020 Prion disease
    717050 (ATF6B)
  09165 Substance dependence
   05030 Cocaine addiction
    717050 (ATF6B)
   05031 Amphetamine addiction
    717050 (ATF6B)
   05034 Alcoholism
    717050 (ATF6B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    717050 (ATF6B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    717050 (ATF6B)
   05161 Hepatitis B
    717050 (ATF6B)
   05163 Human cytomegalovirus infection
    717050 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcc03000]
    717050 (ATF6B)
Transcription factors [BR:mcc03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    717050 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf DUF4407 ZapB GIT_CC YabA Docking
Other DBs
NCBI-GeneID: 717050
NCBI-ProteinID: XP_014991523
Ensembl: ENSMMUG00000015229
LinkDB
Position
4
AA seq 711 aa
MVGGWGGKMAELMLLSEIADPTRFFADNLLSPEDWGLQNSTLYSGLDEVAEEQTQLFRCP
EQDVPFDGSSLDVGMDVSPPEPPWELLPILPDLQVKSEPSSPCSSSSRSSESSHLSTEPS
SEALGVGEVLHVKTESLAPPLCLLGDDLTSSFETVQINVVPTSDDCSDVQTKIEPVSPCS
SINSEASLLSADSSSQAFIGEEVLEVKTESLSPSGCLLWDVPAPSLGAVQISMGPSPDGS
SGKALPIRKPPLQPKPVVLTTVPMPPRAVPPSTTVLLQPLVQPPPVSPVVLIQGAIRVQP
EGPAAALPRPERKSIVPAPMPGNSCPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQG
LEARLQAVLADNQQLRRENAALRRRLEALLAENSELKLGSGNRKVVCIMVFLLFIAFNFG
PVSISEPPSAPVSPRMNKGEPRPRRHLLGFSEQEPVHGVEPLQGSSQGPEEPQPSPTDQP
SFRNLTTFPGGAKELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKIPQ
RAQERQKSQPRKKSPPVKAVPIQPPGPPERDSVGQLQLYRHPDRSQPAFLDAIDRREDTF
YVVSFRRDHLLLPAISHNKTSRPKMSLVMPAMAPNETLSGRGAPGDYEEMMQIECEVMDT
RVIHIKTSTVPPSLRKQPSPTPGNATGGPLPASAASQAHQASHQPLYLNHP
NT seq 2136 nt   +upstreamnt  +downstreamnt
atggttggggggtgggggggaaagatggcggagctgatgctcctcagcgagattgccgac
ccgacgcgtttcttcgccgacaacctgctgagcccggaggactggggtctgcagaacagc
accttgtattctggcctagatgaagtggccgaggagcagacgcagctcttccgttgcccc
gagcaggatgtcccgtttgacggcagctccctggacgtggggatggatgtcagcccccct
gagcccccatgggaactcctgccgatcttgccagatcttcaggtgaagtctgagccgtct
tccccctgctcttcctcctcccgcagctccgagtcatcacatctctccacagagccctcc
agcgaggctcttggggtaggggaggtgctccatgtgaagacagagtccttggcaccccca
ctgtgtctcctgggagatgacctaacatcctcatttgaaactgtccagatcaacgtagtc
cccacttctgatgattgctcagatgtccagaccaagatagaacctgtctctccatgttct
tccatcaactctgaggcctccctgctctcagccgactcctccagccaggcttttatagga
gaggaggtcctggaagtgaagacagagtccctatccccttcagggtgcctcctatgggat
gtcccagccccctcacttggagctgtccagatcagcatgggcccatcccctgatggctcc
tcagggaaagccctgcccatccggaagccaccactgcagcccaaacctgtggtgctaacc
actgtcccaatgccacccagagctgtgcctcccagcaccaccgtccttctgcagcccctt
gtccagccacccccagtatccccagttgtcctcatccagggtgctattcgagtccagcct
gaagggccggctgccgctctcccacggcctgagaggaagagcatcgttcctgctcctatg
cctggaaactcctgcccgcctgaagtggatgcaaagctgctgaagcggcagcagcgaatg
atcaagaaccgggagtcagcctgccagtcccggagaaagaaaaaagagtatctgcagggg
ctggaggctcggctgcaggcagtgctggctgacaaccagcagctccgccgggagaatgct
gccctccggcggcggctggaggccctgctggctgaaaacagcgagctcaagttagggtct
ggaaacaggaaggtggtctgcatcatggtcttccttctcttcattgccttcaactttgga
cccgtcagcatcagtgagcctccttcagctcctgtctctcctcggatgaacaagggggag
cctcgaccccggagacacttgctggggttctcagagcaagagccagttcatggagttgaa
cctctccaggggtcctcccagggccctgaagagccccagcccagccccacagaccagccc
agtttcaggaacctgacaaccttccctgggggcgccaaggagctactactaagagaccta
gaccagctcttcctctcctctgattgccggcacttcaaccgcaccgagtccctgaggctt
gctgacgagctgagtggctgggtccagcgccaccagagaggccggcggaagatccctcag
agggcccaggagagacagaagtctcagccacggaagaagtcacctccagttaaggcagtc
cccatccaaccccctggacccccggaaagggattctgtgggccagctgcagctatatcgc
cacccagaccgttcgcagccagcgttcttggatgcaattgaccgacgggaagacacgttt
tatgttgtctctttccgaagagaccacctgctgctcccagccatcagccacaacaagacc
tcccggcccaagatgtccctggtgatgccggccatggcccccaatgagaccctgtcaggc
cgtggggccccgggggactatgaggagatgatgcagatcgagtgtgaggtcatggacacc
agggtgattcacatcaagacctccacggtgcccccctcgctccgaaaacagccatcccca
accccaggcaatgccacaggtggccccttgccagcttctgcagccagccaggcccatcag
gcctcccaccagcccctctacctcaatcatccctga

KEGG   Macaca mulatta (rhesus monkey): 721825
Entry
721825            CDS       T01028                                 

Gene name
CREB3L3
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 3 isoform X1
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04022  cGMP-PKG signaling pathway
mcc04024  cAMP signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04152  AMPK signaling pathway
mcc04211  Longevity regulating pathway
mcc04261  Adrenergic signaling in cardiomyocytes
mcc04668  TNF signaling pathway
mcc04714  Thermogenesis
mcc04725  Cholinergic synapse
mcc04728  Dopaminergic synapse
mcc04911  Insulin secretion
mcc04915  Estrogen signaling pathway
mcc04916  Melanogenesis
mcc04918  Thyroid hormone synthesis
mcc04922  Glucagon signaling pathway
mcc04925  Aldosterone synthesis and secretion
mcc04926  Relaxin signaling pathway
mcc04927  Cortisol synthesis and secretion
mcc04928  Parathyroid hormone synthesis, secretion and action
mcc04931  Insulin resistance
mcc04934  Cushing syndrome
mcc04935  Growth hormone synthesis, secretion and action
mcc04962  Vasopressin-regulated water reabsorption
mcc05016  Huntington disease
mcc05020  Prion disease
mcc05030  Cocaine addiction
mcc05031  Amphetamine addiction
mcc05034  Alcoholism
mcc05161  Hepatitis B
mcc05163  Human cytomegalovirus infection
mcc05165  Human papillomavirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05203  Viral carcinogenesis
mcc05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    721825 (CREB3L3)
   04024 cAMP signaling pathway
    721825 (CREB3L3)
   04022 cGMP-PKG signaling pathway
    721825 (CREB3L3)
   04151 PI3K-Akt signaling pathway
    721825 (CREB3L3)
   04152 AMPK signaling pathway
    721825 (CREB3L3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    721825 (CREB3L3)
   04922 Glucagon signaling pathway
    721825 (CREB3L3)
   04915 Estrogen signaling pathway
    721825 (CREB3L3)
   04926 Relaxin signaling pathway
    721825 (CREB3L3)
   04935 Growth hormone synthesis, secretion and action
    721825 (CREB3L3)
   04918 Thyroid hormone synthesis
    721825 (CREB3L3)
   04928 Parathyroid hormone synthesis, secretion and action
    721825 (CREB3L3)
   04916 Melanogenesis
    721825 (CREB3L3)
   04925 Aldosterone synthesis and secretion
    721825 (CREB3L3)
   04927 Cortisol synthesis and secretion
    721825 (CREB3L3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    721825 (CREB3L3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    721825 (CREB3L3)
  09156 Nervous system
   04725 Cholinergic synapse
    721825 (CREB3L3)
   04728 Dopaminergic synapse
    721825 (CREB3L3)
  09149 Aging
   04211 Longevity regulating pathway
    721825 (CREB3L3)
  09159 Environmental adaptation
   04714 Thermogenesis
    721825 (CREB3L3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    721825 (CREB3L3)
  09162 Cancer: specific types
   05215 Prostate cancer
    721825 (CREB3L3)
  09164 Neurodegenerative disease
   05016 Huntington disease
    721825 (CREB3L3)
   05020 Prion disease
    721825 (CREB3L3)
  09165 Substance dependence
   05030 Cocaine addiction
    721825 (CREB3L3)
   05031 Amphetamine addiction
    721825 (CREB3L3)
   05034 Alcoholism
    721825 (CREB3L3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    721825 (CREB3L3)
   04934 Cushing syndrome
    721825 (CREB3L3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    721825 (CREB3L3)
   05161 Hepatitis B
    721825 (CREB3L3)
   05163 Human cytomegalovirus infection
    721825 (CREB3L3)
   05165 Human papillomavirus infection
    721825 (CREB3L3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcc03000]
    721825 (CREB3L3)
Transcription factors [BR:mcc03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    721825 (CREB3L3)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf pEK499_p136 ADIP DUF1664
Other DBs
NCBI-GeneID: 721825
NCBI-ProteinID: XP_014977982
LinkDB
Position
19
AA seq 461 aa
MNMDLAAGKMACSACPMDPIDSFELLDLLFDRQDGILRHVELGDDWGHVKDQQVQPNPDP
DDFLSSILGSGDSLPSSPLWSPEGSDSGISEDLPSDPQDTPPRSGPATSPAGCHPAQPGK
GPCLSYHPGNSCPTTPPGPVVQVPEASVTIDLEMWSPGGRTYAEKQADPVHVPPRCNLTV
KDLLLSGSSGDLQQHHLGVSHLLRPGAEHCQELVLTEDEKKLLAKEGITLPTQLPLTKYE
ERVLKKIRRKIRNKQSAQESRKKKKEYIDGLETRMSACTAQNQELQRKVLHLEKQNLSLL
EQLKKLQAIVVQSTSKSVQTGTCVAVLLLSFALIILPSISPFGPNKAESPGDFAPVRVFS
RTLHNDAASRVTSDAVPGSEAPGPQPEADTTQEGSPGIPGADWDFQDSANLTNSTEEVDN
ATLILRNATEGLGQVTLLDWVAPGPSTGSGRAGLEAAGDEL
NT seq 1386 nt   +upstreamnt  +downstreamnt
atgaatatggatttagctgctggaaagatggcttgttctgcctgccccatggaccccatc
gacagctttgagctcctggatctcctgtttgaccggcaggacggcatcctgagacacgtg
gagctgggcgacgactggggccacgtcaaggaccagcaggtccagccaaaccctgaccct
gacgacttcctcagctccatcctgggctccggagactcactgcccagctccccactctgg
tcccccgaaggcagtgacagtggcatctctgaagacctcccctccgacccccaggacacc
cctccacgcagcggaccggccacctccccagccggctgccatcctgcccagcctggcaag
gggccctgcctctcctatcatcctggcaactcttgccccaccacacccccagggccagtg
gtccaagtgcccgaagcctctgtgaccatagacctggaaatgtggagtccaggaggaagg
acctatgctgagaaacaggctgacccggtgcacgtgcccccacgatgcaatctcaccgtg
aaagacctcctcctttcgggcagcagcggggacctgcaacagcatcacctgggggtctcc
cacctcctgagacctggggctgagcactgtcaggagctggtgctcactgaggatgagaag
aaactgctggctaaagaaggcatcaccctgcccactcagctgcccctcactaaatacgag
gagcgagtgctgaaaaaaatccgccggaaaatccggaacaagcagtcggcccaagaaagc
aggaagaagaaaaaggaatacatagacggcctggagactcggatgtcagcttgcactgct
cagaatcaggagttacagaggaaagtcttgcatctcgagaagcaaaacctgtccctcttg
gagcagctgaagaaactccaggccattgtggtgcaatccaccagcaagtcagtccagaca
ggcacctgcgtcgcggtcctgttgctgtcctttgccctcatcatcctcccctccatcagc
ccttttggccccaacaaagccgagagtcccggggactttgcgcctgtgcgagtgttctcc
agaactttgcacaacgatgctgcctcccgcgtgacctctgatgctgtgccgggctccgag
gccccaggaccccaacccgaggctgacacaacccaagaagggtctccaggaatccctggg
gcagactgggacttccaggacagtgcgaacctgaccaattcgacggaggaggtagataat
gccaccctgatcctgaggaatgcaacagaggggctgggccaggtcaccctgctggactgg
gtggcacctgggccgagcactggctcaggacgtgcagggctggaggcggcgggagacgag
ctgtga

DBGET integrated database retrieval system