KEGG   Macaca mulatta (rhesus monkey): 696494
Entry
696494            CDS       T01028                                 

Gene name
MYD88
Definition
(RefSeq) myeloid differentiation primary response protein MyD88
  KO
K04729  myeloid differentiation primary response protein MyD88
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04010  MAPK signaling pathway
mcc04064  NF-kappa B signaling pathway
mcc04620  Toll-like receptor signaling pathway
mcc04621  NOD-like receptor signaling pathway
mcc05132  Salmonella infection
mcc05133  Pertussis
mcc05134  Legionellosis
mcc05135  Yersinia infection
mcc05140  Leishmaniasis
mcc05142  Chagas disease
mcc05143  African trypanosomiasis
mcc05144  Malaria
mcc05145  Toxoplasmosis
mcc05152  Tuberculosis
mcc05161  Hepatitis B
mcc05162  Measles
mcc05164  Influenza A
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05171  Coronavirus disease - COVID-19
mcc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    696494 (MYD88)
   04064 NF-kappa B signaling pathway
    696494 (MYD88)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    696494 (MYD88)
   04621 NOD-like receptor signaling pathway
    696494 (MYD88)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    696494 (MYD88)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    696494 (MYD88)
   05135 Yersinia infection
    696494 (MYD88)
   05133 Pertussis
    696494 (MYD88)
   05134 Legionellosis
    696494 (MYD88)
   05152 Tuberculosis
    696494 (MYD88)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    696494 (MYD88)
   05161 Hepatitis B
    696494 (MYD88)
   05171 Coronavirus disease - COVID-19
    696494 (MYD88)
   05164 Influenza A
    696494 (MYD88)
   05162 Measles
    696494 (MYD88)
   05168 Herpes simplex virus 1 infection
    696494 (MYD88)
   05169 Epstein-Barr virus infection
    696494 (MYD88)
  09174 Infectious disease: parasitic
   05144 Malaria
    696494 (MYD88)
   05145 Toxoplasmosis
    696494 (MYD88)
   05140 Leishmaniasis
    696494 (MYD88)
   05142 Chagas disease
    696494 (MYD88)
   05143 African trypanosomiasis
    696494 (MYD88)
SSDB
Motif
Pfam: Death TIR TIR_2
Other DBs
NCBI-GeneID: 696494
NCBI-ProteinID: NP_001124153
Ensembl: ENSMMUG00000000995
UniProt: B3Y683
LinkDB
Position
2
AA seq 296 aa
MAAGGPGTEPAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWTALAEEMDFEYLE
IRQLETHADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQ
QQEEAEKPLQVAAVDSSVPRTAELAGITTLDDPLGHMPERFDAFICYCPSDIQFVQEMIR
QLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFA
LSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLP
NT seq 891 nt   +upstreamnt  +downstreamnt
atggctgcaggaggtcccggcactgagcctgcggccccggtctcctccacatcctccctt
cccctggctgctctcaacatgcgagtgcggcgccgcctatctctgttcttgaacgtgcgg
acacaggtggcggccgactggaccgcgctggcggaggagatggactttgagtacttggag
atccggcaactggagacgcacgccgaccccactggcaggctgctggacgcctggcaggga
cgccctggcgcctcggtaggccgactgctggagctgcttaccaagctgggccgcgacgac
gtgctgctggagctgggacccagcattgaggaagattgccaaaagtatatcttgaagcag
cagcaggaggaggctgagaagcctttacaggtggccgctgtagacagcagtgtcccacgg
acagcagaactggcgggcatcaccacacttgacgaccccctggggcatatgcctgagcgt
ttcgatgccttcatctgctattgccccagcgacatccagtttgtgcaggagatgatccgg
caactggaacagacaaactatcgactgaagttgtgtgtgtctgaccgtgatgtcctgcct
ggcacctgtgtctggtccattgctagtgaactcatcgaaaagaggtgccgccggatggtg
gtggttgtctctgatgattacctgcagagcaaggaatgtgacttccagaccaaatttgca
ctcagcctctctccaggtgcccatcagaagcgactgatccccatcaagtacaaggcaatg
aagaaagagttccccagcatcctgaggttcatcactgtctgcgattacaccaacccctgc
accaaatcttggttctggactcgccttgccaaggccttgtccctgccctga

DBGET integrated database retrieval system