KEGG   Macaca mulatta (rhesus monkey): 696556
Entry
696556            CDS       T01028                                 

Gene name
WASL
Definition
(RefSeq) neural Wiskott-Aldrich syndrome protein
  KO
K23612  neural Wiskott-Aldrich syndrome protein
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04144  Endocytosis
mcc04520  Adherens junction
mcc04810  Regulation of actin cytoskeleton
mcc05100  Bacterial invasion of epithelial cells
mcc05132  Salmonella infection
mcc05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    696556 (WASL)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    696556 (WASL)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    696556 (WASL)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    696556 (WASL)
   05135 Yersinia infection
    696556 (WASL)
   05100 Bacterial invasion of epithelial cells
    696556 (WASL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    696556 (WASL)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mcc04812]
    696556 (WASL)
Membrane trafficking [BR:mcc04131]
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    696556 (WASL)
Cytoskeleton proteins [BR:mcc04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    WASP / WAVE
     696556 (WASL)
SSDB
Motif
Pfam: WH1 PBD WH2 DUF4918 PQQ
Other DBs
NCBI-GeneID: 696556
NCBI-ProteinID: NP_001253726
Ensembl: ENSMMUG00000011544
UniProt: F7BU81
LinkDB
Position
3
AA seq 505 aa
MSSVQQQPPPPRRVTNVGSLLLTPQENESLFTFLGKKCVTMSSAVVQLYAADRNCMWSKK
CSGVACLVKDNPQRSYFLRIFDIKDGKLLWEQELYNNFVYNSPRGYFHTFAGDTCQVALN
FANEEEAKKFRKAVTDLLGRRQRKSEKRRDPPNGPNLPMATVDIKNPEITTNRFYGPQVN
NISHTKEKKKGKAKKKRLTKADIGTPSNFQHIGHVGWDPNTGFDLNNLDPELKNLFDMCG
ISEAQLKDRETSKVIYDFIEKTGGVEAVKNELRRQAPPPPPPSRGGPPPPPPPPHNSGPP
PPPARGRGAPPPPPSRAPTAAPPPPPPSRPSVAVPPPPPNRMYPPPPPALPSSAPSGPPP
PPPSVLGVGPVAPPPPPPPPPPPGPPPPTGLPSDGDHQVPTTAGNKAALLDQIREGAQLK
KVEQNSRPVSCSGRDALLDQIRQGIQLKSVSDGPESTPPTPAPTSGIVGALMEVMQKRSK
AIHSSDEDEDEDDEEDFEDDDEWED
NT seq 1518 nt   +upstreamnt  +downstreamnt
atgagctccgtccagcagcagccgccgccgccgcggagggtcaccaacgtggggtccctg
ctgctcaccccgcaggagaacgagtccctcttcactttcctcggcaagaaatgtgtgact
atgtcttcagcagtggtgcagttatatgcagcagatcggaactgtatgtggtcaaagaag
tgcagtggtgttgcttgtcttgttaaggacaatccacagagatcttattttttaagaata
tttgacattaaggatgggaaactattgtgggaacaagagctatacaataactttgtatat
aatagtcctagaggatattttcatacctttgctggagatacttgtcaagttgctcttaat
tttgccaatgaagaagaagcaaaaaaattccgaaaagcagttacagacctgttgggccgc
cgacaaaggaaatctgagaaaagacgagatcccccaaatggtcctaatctacccatggct
acagtcgacataaaaaatccagaaatcacaacaaatagattttatggtccacaagtcaac
aacatctcccataccaaagaaaagaaaaaaggaaaagctaaaaagaagagattaaccaag
gcagatataggaacaccaagcaatttccagcacattggacatgttggttgggatccaaat
acaggctttgatctgaataatttggatccagaattgaagaatctttttgatatgtgtgga
atctcagaggcacagcttaaagacagagaaacatcaaaagttatatatgactttattgaa
aaaacaggaggtgttgaagctgttaaaaatgaactgcgaaggcaagcaccaccacctcca
ccaccatcaaggggagggccacctcctcctcctccccctccacacaactcaggtcctcct
cctcctcctgccaggggaagaggcgctcctcccccaccaccttcaagagctcccacagct
gcacctccaccaccgcctccttccaggccaagtgtagcagtccctccaccaccgccaaat
aggatgtaccctcctccacctccagcccttccctcctcagcaccttcagggcctccacca
ccacctccatctgtgttgggggtagggccagtggcaccacccccaccgcctccacctccg
cctccacctgggccaccgccccccactggcctgccttctgacggggaccatcaggttcca
actactgcaggaaacaaagcagctcttttagatcaaattagagagggtgctcagctaaaa
aaagtggagcagaacagtcggccagtgtcctgctctggacgagatgcactgttagaccag
atacgacagggtatccaactaaagtctgtgtctgatggcccagagtctacaccaccaaca
cctgcacccacttcaggaattgtgggtgcattaatggaagtgatgcagaaaaggagcaaa
gccattcattcttcagatgaagatgaagatgaagatgatgaagaagattttgaggatgat
gatgagtgggaagactga

DBGET integrated database retrieval system