KEGG   Macaca mulatta (rhesus monkey): 696584
Entry
696584            CDS       T01028                                 

Gene name
CRKL
Definition
(RefSeq) crk-like protein
  KO
K04438  C-crk adapter molecule crk
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04010  MAPK signaling pathway
mcc04012  ErbB signaling pathway
mcc04015  Rap1 signaling pathway
mcc04062  Chemokine signaling pathway
mcc04510  Focal adhesion
mcc04666  Fc gamma R-mediated phagocytosis
mcc04722  Neurotrophin signaling pathway
mcc04810  Regulation of actin cytoskeleton
mcc04910  Insulin signaling pathway
mcc04935  Growth hormone synthesis, secretion and action
mcc05100  Bacterial invasion of epithelial cells
mcc05135  Yersinia infection
mcc05163  Human cytomegalovirus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05200  Pathways in cancer
mcc05206  MicroRNAs in cancer
mcc05211  Renal cell carcinoma
mcc05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    696584 (CRKL)
   04012 ErbB signaling pathway
    696584 (CRKL)
   04015 Rap1 signaling pathway
    696584 (CRKL)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    696584 (CRKL)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    696584 (CRKL)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    696584 (CRKL)
   04062 Chemokine signaling pathway
    696584 (CRKL)
  09152 Endocrine system
   04910 Insulin signaling pathway
    696584 (CRKL)
   04935 Growth hormone synthesis, secretion and action
    696584 (CRKL)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    696584 (CRKL)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    696584 (CRKL)
   05206 MicroRNAs in cancer
    696584 (CRKL)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    696584 (CRKL)
   05211 Renal cell carcinoma
    696584 (CRKL)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    696584 (CRKL)
   05100 Bacterial invasion of epithelial cells
    696584 (CRKL)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    696584 (CRKL)
   05163 Human cytomegalovirus infection
    696584 (CRKL)
Domain-containing proteins not elsewhere classified [BR:mcc04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   696584 (CRKL)
SSDB
Motif
Pfam: SH3_2 SH2 SH3_1 SH3_9 hSH3
Other DBs
NCBI-GeneID: 696584
NCBI-ProteinID: NP_001244412
UniProt: F6VK11 G7N3B4
LinkDB
Position
10
AA seq 303 aa
MSSARFDSSDRSAWYMGPVSRQEAQTRLQGQRHGMFLVRDSSTCPGDYVLSVSENSRVSH
YIINSLPNRRFKIGDQEFDHLPALLEFYKIHYLDTTTLIEPAPRYPSPPMGSVSAPNLPT
AEDNLEYVRTLYDFPGNDAEDLPFKKGEILVIIEKPEEQWWSARNKDGRVGMIPVPYVEK
LVRSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPAVSGSPGAAITPLPSTQNGPVFA
KAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIFDPQNPD
ENE
NT seq 912 nt   +upstreamnt  +downstreamnt
atgtcctctgccaggttcgactcctcggaccgctccgcctggtacatggggccggtgtct
cgccaggaggcgcagacccggctccagggccagcgccacggtatgttcctcgtccgcgat
tcttccacctgccctggggactatgtgctgtcggtgtccgagaactcgcgggtctcccac
tacatcatcaactcgctgcccaaccgccgttttaagatcggggaccaggagtttgaccat
ttgccggccctgctggagttttacaagatccactacctggacaccaccactctcatcgaa
cccgcgcccaggtatccaagcccaccaatgggctctgtctcagcacccaacctgcctaca
gcagaagataatctggaatatgtacggactctgtatgattttcctggaaatgatgccgaa
gacctgccgtttaaaaagggtgagatcctagtgataatagagaagcctgaagaacagtgg
tggagtgcccggaacaaggatggccgggttgggatgattcctgtcccttatgtcgaaaag
cttgtgagatcctcaccacacggaaagcatggaaataggaattccaacagttatgggatc
ccagaacctgctcatgcgtacgctcaacctcagaccacaactcctctacctgcagtttcc
ggttctcctggggcagcaatcacccctttgccatccacacagaatggacctgtctttgcg
aaagcaatccagaaaagagtaccctgtgcttatgacaagactgccttggcactagaggtt
ggtgacattgtgaaagtcacaaggatgaatataaatggccagtgggaaggcgaggtgaat
gggcgcaaagggctttttccctttacgcatgtcaaaatctttgaccctcaaaacccagat
gaaaatgagtga

KEGG   Macaca mulatta (rhesus monkey): 701185
Entry
701185            CDS       T01028                                 

Gene name
CRK
Definition
(RefSeq) adapter molecule crk isoform X1
  KO
K04438  C-crk adapter molecule crk
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04010  MAPK signaling pathway
mcc04012  ErbB signaling pathway
mcc04015  Rap1 signaling pathway
mcc04062  Chemokine signaling pathway
mcc04510  Focal adhesion
mcc04666  Fc gamma R-mediated phagocytosis
mcc04722  Neurotrophin signaling pathway
mcc04810  Regulation of actin cytoskeleton
mcc04910  Insulin signaling pathway
mcc04935  Growth hormone synthesis, secretion and action
mcc05100  Bacterial invasion of epithelial cells
mcc05135  Yersinia infection
mcc05163  Human cytomegalovirus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05200  Pathways in cancer
mcc05206  MicroRNAs in cancer
mcc05211  Renal cell carcinoma
mcc05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    701185 (CRK)
   04012 ErbB signaling pathway
    701185 (CRK)
   04015 Rap1 signaling pathway
    701185 (CRK)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    701185 (CRK)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    701185 (CRK)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    701185 (CRK)
   04062 Chemokine signaling pathway
    701185 (CRK)
  09152 Endocrine system
   04910 Insulin signaling pathway
    701185 (CRK)
   04935 Growth hormone synthesis, secretion and action
    701185 (CRK)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    701185 (CRK)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    701185 (CRK)
   05206 MicroRNAs in cancer
    701185 (CRK)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    701185 (CRK)
   05211 Renal cell carcinoma
    701185 (CRK)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    701185 (CRK)
   05100 Bacterial invasion of epithelial cells
    701185 (CRK)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    701185 (CRK)
   05163 Human cytomegalovirus infection
    701185 (CRK)
Domain-containing proteins not elsewhere classified [BR:mcc04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   701185 (CRK)
SSDB
Motif
Pfam: SH3_2 SH2 SH3_1 SH3_9 SH3_10 DUF3804
Other DBs
NCBI-GeneID: 701185
NCBI-ProteinID: XP_002808155
Ensembl: ENSMMUG00000040390
UniProt: H9FQ57
LinkDB
Position
16
AA seq 304 aa
MAGNFDSEERSSWYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHY
IINSSGPRPPVPPSPAQPPPGVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSR
SRQGSGVILRQEEAEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRG
MIPVPYVEKYRPASASVSALIGGNQEGSHPQPLGGPEPGPYAQPSVNTPLPNLQNGPIYA
RVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGECNGKRGHFPFTHVRLLDQQNPD
EDFS
NT seq 915 nt   +upstreamnt  +downstreamnt
atggcgggcaacttcgactcggaggagcggagtagctggtactgggggcggttgagtcgg
caggaggcggtggcgctgctgcagggccagcggcacggggtgttcctggtgcgggactcg
agcaccagccccggggactatgtgctcagcgtctcagagaactcgcgcgtctcccactac
atcatcaacagcagcggcccgcgcccgccagtgccgccgtcgcccgcccaacctccgccg
ggggtgagcccctccagactccgaataggagatcaagagtttgattcattgcctgcttta
ctggaattctacaaaatacactatttggacactacaacgttgatagaaccggtttccaga
tccaggcagggtagtggagtgattctcaggcaggaggaggcggagtatgtgcgagccctc
tttgactttaatgggaatgatgaggaagatcttccctttaagaaaggagacatcttgaga
atccgggacaagcctgaagagcagtggtggaatgcggaggacagcgaaggcaagagaggg
atgattccagtcccttacgtcgagaagtatagacctgcctccgcctcagtatcggctctg
attggaggtaaccaggagggttcccacccacagccactgggtgggccggagcctgggccc
tatgcccaacccagcgtcaacactccgctccctaacctccagaatgggcccatatatgcc
agggttatccagaagcgagtccccaatgcctacgacaagacagccttggctttggaggtc
ggtgagctggtaaaggttacgaagattaatgtgagtggtcagtgggaaggggagtgtaat
ggcaaacgaggtcacttcccattcacacatgtccgtctgctggatcaacagaatcccgat
gaggacttcagctga

DBGET integrated database retrieval system