KEGG   Macaca mulatta (rhesus monkey): 696676
Entry
696676            CDS       T01028                                 

Gene name
PAK4
Definition
(RefSeq) serine/threonine-protein kinase PAK 4 isoform X1
  KO
K05734  p21-activated kinase 4 [EC:2.7.11.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04012  ErbB signaling pathway
mcc04014  Ras signaling pathway
mcc04360  Axon guidance
mcc04510  Focal adhesion
mcc04660  T cell receptor signaling pathway
mcc04810  Regulation of actin cytoskeleton
mcc05170  Human immunodeficiency virus 1 infection
mcc05206  MicroRNAs in cancer
mcc05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    696676 (PAK4)
   04014 Ras signaling pathway
    696676 (PAK4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    696676 (PAK4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    696676 (PAK4)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    696676 (PAK4)
  09158 Development and regeneration
   04360 Axon guidance
    696676 (PAK4)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    696676 (PAK4)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    696676 (PAK4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    696676 (PAK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    696676 (PAK4)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     696676 (PAK4)
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: STE group
  STE20 family
   696676 (PAK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal Kdo KIND hnRNP_Q_AcD
Other DBs
NCBI-GeneID: 696676
NCBI-ProteinID: XP_014979379
Ensembl: ENSMMUG00000013140
LinkDB
Position
19
AA seq 597 aa
MFGKRKKRVEISAPSNFEHRVHTGFDQHEQKFTGLPRQWQSLIEESARRPKPLIDPACIT
SIQPGAPKTIVRGSKGAKDGALTLLLDEFENMSVTRSNSLRRDSPPPPARARQENGMPEE
PATTARGGPGKAGSQGRIASHSEAGGGSGDRRRVGPEKRPKSSREGSGGPQEPSRDKRPL
SGPDVGTPQPAGLASGAKLAAGRPFNTYPRADTDHPSRGAQGEPHDVAPNGPSAGGLAVP
QSSSSSSRPPTRARGAPSPGVLGPHASEPQLAPPAHTPAAPAAPAAPAVPGPPGPRSPQR
EPQRVSHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDL
RKQQRRELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNE
EQIAAVCLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRKS
LVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPR
LKNLHKVSPSLKGFLDRLLVRDPAHRATAAELLKHPFLAKAGPPASIVPLMRQNRTR
NT seq 1794 nt   +upstreamnt  +downstreamnt
atgtttgggaagaggaagaagcgggtggagatctccgcgccgtccaacttcgagcaccgc
gtgcacacgggcttcgaccagcatgagcagaagttcacggggctgccccgccagtggcag
agcctgatcgaggagtcggcccgccggccaaagcccctcatcgaccccgcctgcatcacc
tccatccagcccggggcccccaagaccatcgtgcggggcagcaaaggtgccaaggatggg
gcgctcacgctgctgctggatgagtttgagaacatgtcggtgacacgctccaactccctg
cggagagacagcccgccgccgcccgcccgtgcccgccaggaaaatgggatgccggaggag
ccggccaccacggccagagggggcccggggaaggcaggcagccaaggccggatcgccagt
cacagcgaggcgggtggcggcagtggtgacaggcgacgggtggggccagagaagaggccc
aagtcttccagggagggctcaggggggccccaggagccctcccgggacaaacgccccctc
tccgggcctgacgtcggcaccccccagcctgctggtctggccagtggggcgaaattggca
gctggccggccctttaacacctacccgagggctgacacggaccacccatcccggggtgcc
cagggggagcctcatgacgtggccccaaacgggccatcagcggggggcctggccgtcccc
cagtcctcctcctcctcctcccggcctcccacccgagcccgaggtgcccccagccctgga
gtgctgggcccccacgcctcggagccccagctggcccctccagcccacaccccagccgcc
ccagccgcccctgctgcccctgccgtgcccgggccccctggcccccgctcgccacagcgg
gagccgcagcgagtatcccatgagcagttccgggctgccctgcagctggtggtggaccca
ggtgacccccgctcctacctggacaacttcatcaagattggcgagggctccacgggcatt
gtgtgcatcgccaccgtgcgcagctcgggcaagcttgtggccgtcaagaagatggacctg
cgcaagcagcagaggcgcgagctgctcttcaacgaggtggtgatcatgagggactaccag
cacgagaatgtggtggagatgtacaacagctacctggtgggggacgagctctgggtggtc
atggagttcctggaaggaggcgccctcaccgacatcgtcacccacaccaggatgaacgag
gagcagatcgcggccgtgtgcctggcagtgctgcaggcgttgtcggtgctccacgcccag
ggcgtcatccaccgggacatcaagagcgactcgatcctgctgacccatgatggcagggtg
aagctgtcagacttcgggttctgtgcccaggtgagcaaggaagtgccccgaaggaagtcg
ctggtcggcacgccctactggatggccccagagctcatctcccgccttccctacgggcca
gaggtggacatctggtcactggggataatggtgattgagatggtggacggagagcccccc
tacttcaacgagccacccctcaaagccatgaagatgattcgggacaacctgccgccccga
ctgaagaacctgcacaaggtgtcaccatccctgaagggcttcctggaccgcctgctggtg
cgggaccctgcccatcgggccacagcagctgagctgctgaagcacccattcctggccaag
gcggggccgcccgccagcatcgtgcccctcatgcgccagaaccgaaccagatga

KEGG   Macaca mulatta (rhesus monkey): 698585
Entry
698585            CDS       T01028                                 

Gene name
PAK1
Definition
(RefSeq) serine/threonine-protein kinase PAK 1 isoform X5
  KO
K04409  p21-activated kinase 1 [EC:2.7.11.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04010  MAPK signaling pathway
mcc04012  ErbB signaling pathway
mcc04014  Ras signaling pathway
mcc04024  cAMP signaling pathway
mcc04062  Chemokine signaling pathway
mcc04360  Axon guidance
mcc04392  Hippo signaling pathway - multiple species
mcc04510  Focal adhesion
mcc04625  C-type lectin receptor signaling pathway
mcc04650  Natural killer cell mediated cytotoxicity
mcc04660  T cell receptor signaling pathway
mcc04666  Fc gamma R-mediated phagocytosis
mcc04810  Regulation of actin cytoskeleton
mcc05132  Salmonella infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05205  Proteoglycans in cancer
mcc05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    698585 (PAK1)
   04012 ErbB signaling pathway
    698585 (PAK1)
   04014 Ras signaling pathway
    698585 (PAK1)
   04392 Hippo signaling pathway - multiple species
    698585 (PAK1)
   04024 cAMP signaling pathway
    698585 (PAK1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    698585 (PAK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    698585 (PAK1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    698585 (PAK1)
   04650 Natural killer cell mediated cytotoxicity
    698585 (PAK1)
   04660 T cell receptor signaling pathway
    698585 (PAK1)
   04666 Fc gamma R-mediated phagocytosis
    698585 (PAK1)
   04062 Chemokine signaling pathway
    698585 (PAK1)
  09158 Development and regeneration
   04360 Axon guidance
    698585 (PAK1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    698585 (PAK1)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    698585 (PAK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    698585 (PAK1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    698585 (PAK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    698585 (PAK1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    698585 (PAK1)
   03036 Chromosome and associated proteins [BR:mcc03036]
    698585 (PAK1)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     698585 (PAK1)
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: STE group
  STE20 family
   698585 (PAK1)
Membrane trafficking [BR:mcc04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    698585 (PAK1)
 Endocytosis
  Macropinocytosis
   Kinases
    698585 (PAK1)
Chromosome and associated proteins [BR:mcc03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     698585 (PAK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal APH DSHCT Kdo
Other DBs
NCBI-GeneID: 698585
NCBI-ProteinID: XP_014970742
Ensembl: ENSMMUG00000001387
UniProt: H9EM79
LinkDB
Position
14
AA seq 545 aa
MSNNGLDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILP
GDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKN
PQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVSEDEDDD
DDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTSTRDVATSPISPTENNTTPPDALTRNTE
KQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQ
MNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETC
MDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSK
RSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNG
TPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEA
TKNNH
NT seq 1638 nt   +upstreamnt  +downstreamnt
atgtcaaataacggcctagacattcaagacaaacccccagcccctccgatgagaaatacc
agcactatgattggagctggcagcaaagatgctggaaccctaaaccatggttctaaacct
ctgcctccaaacccagaggagaagaaaaagaaggaccgattttaccgatccatcttacct
ggagataaaacaaataaaaagaaagagaaagagcggccagagatttctctcccttcagat
tttgaacacacaattcatgttggttttgatgctgtcacaggggagtttacgggaatgcca
gagcagtgggcccgcttgcttcagacatcaaatatcactaagtcggagcagaagaaaaac
ccgcaggctgttctggatgtgttggagttttacaactcaaagaagacatccaacagccag
aaatacatgagctttacagataagtcagctgaggattataattcttctaatgccttgaat
gtgaaggctgtgtctgagactcctgcagtgccaccagtttcagaagatgaggatgatgat
gatgatgatgctaccccaccaccagtgattgctccacgcccagagcacacaaaatctgta
tacacacggtctgtgattgaaccacttcctgtcacttcaactcgggacgtggctacatct
cccatttcacctactgaaaataacaccactccaccagatgctttgacccggaatactgag
aagcagaagaagaagcctaaaatgtctgatgaggagatcttggagaaattacgaagcata
gtgagtgtgggcgatcctaagaagaaatatacacggtttgagaagattggacaaggtgct
tcaggcaccgtgtacactgcaatggatgtggccacaggacaggaggtggccattaagcag
atgaatcttcagcagcagcccaagaaagagctgattattaatgagatcctggtcatgagg
gaaaacaagaacccaaacattgtgaattacttggacagttacctcgtgggagatgagcta
tgggttgttatggaatacttggctggaggctccttgacagacgtggtgacagaaacatgc
atggatgaaggccagattgcagctgtgtgccgtgagtgtctgcaggctctggagtttttg
cattcgaaccaggtcattcacagagacatcaagagtgacaatattctgttgggaatggat
ggctctgtcaagctaactgattttggattctgtgcacagataaccccagagcagagcaaa
cggagcaccatggtgggaaccccatactggatggcaccagaggttgtgacacgaaaggcc
tatgggcccaaggttgacatctggtccctgggcatcatggccatcgaaatgattgaaggg
gagcctccatacctcaatgaaaaccctctgagagccttgtacctcattgccaccaatggg
accccagaacttcagaacccagagaagctgtcagctatcttccgggactttctgaaccgc
tgtcttgagatggatgtggagaagagaggttcagctaaagagctgctgcagcatcaattc
ctgaagattgccaagcccctctccagcctcactccactgattgctgccgcaaaggaggca
acaaagaacaatcactaa

KEGG   Macaca mulatta (rhesus monkey): 701589
Entry
701589            CDS       T01028                                 

Gene name
PAK6
Definition
(RefSeq) serine/threonine-protein kinase PAK 6
  KO
K05735  p21-activated kinase 6 [EC:2.7.11.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04012  ErbB signaling pathway
mcc04014  Ras signaling pathway
mcc04360  Axon guidance
mcc04510  Focal adhesion
mcc04660  T cell receptor signaling pathway
mcc04810  Regulation of actin cytoskeleton
mcc05170  Human immunodeficiency virus 1 infection
mcc05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    701589 (PAK6)
   04014 Ras signaling pathway
    701589 (PAK6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    701589 (PAK6)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    701589 (PAK6)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    701589 (PAK6)
  09158 Development and regeneration
   04360 Axon guidance
    701589 (PAK6)
 09160 Human Diseases
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    701589 (PAK6)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    701589 (PAK6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    701589 (PAK6)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     701589 (PAK6)
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: STE group
  STE20 family
   701589 (PAK6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal Kdo
Other DBs
NCBI-GeneID: 701589
NCBI-ProteinID: NP_001248582
Ensembl: ENSMMUG00000020534
UniProt: F6TWF0 G7MWM9
LinkDB
Position
7
AA seq 681 aa
MFRKKKKKRPEISAPQNFQHRVHTSFDPKEGKFVGLPPQWQNILDTLRRPKPVVDPSRIT
RVQLQPMKTVVRGSAVPVDGYISGLLNDIQKLSVISSNTLRGRSPTSRRRAQSLGLLGDE
HWATDPDMYLQSPQSERTDPHGLYLSCNGGTPAGHKQMPWPEPQSPRVLPNGLAAKAQSL
GPAEFQGASPRCLQLGACLQSSPPGASPPTTTGRRGMKAAKHGSEEARPQSCLVGSATGR
PGGEGSPSPKTQESSLKRRLFRSMFLSTAATAPPSSSKPGPPPQNKPNSSFRPPQKDNPP
SLVAKAQSLPSDQPVGTFSPLTTSDTSSPQKSLRTAPATGPLPGRSSPAGSPRTWHTQIS
TSNLYLPQDPTVAKGTLAGEDTGVVTHEQFKAALRMVVDQGDPRLLLDSYVKIGEGSTGI
VCLAREKHSGRQVAVKMMDLRKQQRRELLFNEVVIMRDYQHFNVVEMYKSYLVGEELWVL
MEFLQGGALTDIVSQVRLNEEQIATVCEAVLQALAYLHAQGVIHRDIKSDSILLTLDGRV
KLSDFGFCAQISKDVPKRKSLVGTPYWMAPEVISRSLYATEVDIWSLGIMVIEMVDGEPP
YFSDSPVQAMKRLRDSPPPKLKNSHKVSPVLRDFLERMLVRDPQERATAQELLDHPFLLQ
TGLPECLVPLIQLYRKQTSTC
NT seq 2046 nt   +upstreamnt  +downstreamnt
atgttccgcaagaaaaagaagaaacgccctgagatctcagccccacagaacttccagcac
cgtgtccacacctccttcgaccccaaagaaggcaagtttgtgggccttcccccacaatgg
cagaacatcctggacacactgcggcgccccaagcccgtggtggacccttcgcgaatcaca
cgggtgcagctccagcccatgaagacagtggtgcggggcagcgcggtgccagtggatggc
tacatctcggggctgctcaacgacatccagaagttgtcggtcatcagctccaacaccctg
cgcggccgcagtcccaccagccggcggcgggcacagtccctggggctgctgggggatgag
cactgggccaccgacccagacatgtacctccagagtccccagtctgagcgcactgacccc
cacggcctctacctcagctgcaacgggggcacaccagcaggccacaagcagatgccgtgg
cccgagccacagagcccacgggtcctgcccaatgggctggctgcaaaggcacagtccctg
ggccccgccgaatttcagggtgcctcaccgcgctgtctgcagctgggtgcttgcctgcag
agctccccaccaggagcctcaccccccacaaccactggtaggcgtggaatgaaggctgcc
aagcatggctctgaggaggcccggccacagtcctgcctggtgggctcagccacaggcagg
ccaggtggggaaggcagccctagccctaagacccaggagagcagcctgaagcgtaggcta
ttccgaagcatgttcctgtccactgctgccacggcccctccaagcagcagcaagccaggc
cctccaccacagaacaagcccaactcctctttccgaccgccacagaaagacaaccctcca
agcctggtggccaaggcccagtccttgccctcggaccagccggtggggaccttcagccct
ctgaccacttcggataccagcagcccccagaagtccctccgcacagccccggccacaggt
ccgcttccaggccggtcttccccagcaggttccccccgcacctggcacacccagatcagc
accagcaacctgtacctgccccaggaccccacggttgccaagggcactctggctggtgag
gacacaggtgttgtgacacatgagcagttcaaggctgcactcaggatggtggtggaccag
ggtgacccccggctgttgctggacagctacgtgaagattggcgagggctccaccggcatc
gtctgtttggcccgggagaagcactcgggccgccaggtggccgtcaagatgatggacctc
aggaagcagcagcgcagggagctgctcttcaacgaggtggtgatcatgcgggactaccag
cacttcaacgtggtggagatgtacaagagctacctagtgggcgaggagctgtgggtgctc
atggagttcctgcagggaggagccctcacagacatcgtctcccaagtcaggctgaatgaa
gagcagatcgccactgtgtgtgaggctgtgctgcaggccctggcttacctgcatgcccag
ggtgtcatccaccgggacatcaagagtgactccatcctgctgaccctggatggcagggtg
aagctctcggacttcggattctgtgctcagatcagcaaagacgtccctaagaggaagtcc
ctggtgggaaccccctactggatggctcctgaagtgatctccaggtctttgtatgccact
gaggtggatatctggtctctgggcatcatggtgattgagatggtggatggggagccaccc
tacttcagtgactccccagtgcaagccatgaagaggctccgggacagccccccgcccaag
ctgaaaaactctcacaaggtctccccagtgctgcgagacttcctggagcggatgctggtg
cgggacccccaagagagagccacagcccaggagctcctagaccaccccttcctgctgcag
acagggctacccgagtgcctggtgcccctgatccagctctaccgcaagcagacctccacc
tgctga

KEGG   Macaca mulatta (rhesus monkey): 706217
Entry
706217            CDS       T01028                                 

Gene name
PAK3
Definition
(RefSeq) serine/threonine-protein kinase PAK 3 isoform X1
  KO
K05733  p21-activated kinase 3 [EC:2.7.11.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04012  ErbB signaling pathway
mcc04014  Ras signaling pathway
mcc04360  Axon guidance
mcc04510  Focal adhesion
mcc04660  T cell receptor signaling pathway
mcc04810  Regulation of actin cytoskeleton
mcc05132  Salmonella infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    706217 (PAK3)
   04014 Ras signaling pathway
    706217 (PAK3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    706217 (PAK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    706217 (PAK3)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    706217 (PAK3)
  09158 Development and regeneration
   04360 Axon guidance
    706217 (PAK3)
 09160 Human Diseases
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    706217 (PAK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    706217 (PAK3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    706217 (PAK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    706217 (PAK3)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     706217 (PAK3)
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: STE group
  STE20 family
   706217 (PAK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Pkinase_fungal Kinase-like Spt5_N APH DSHCT Ribosomal_60s Kdo
Other DBs
NCBI-GeneID: 706217
NCBI-ProteinID: XP_014983498
Ensembl: ENSMMUG00000018763
LinkDB
Position
X
AA seq 562 aa
MSDGLDNEEKPPAPPLRMNSNNRDSSALNHSSKPLPMAPEEKNKKARLRSIFPGGGDKTN
KKKEKERPEISLPSDFEHTIHVGFDAVTGEFTPDLYGSQMCPGKLPEGIPEQWARLLQTS
NITKLEQKKNPQAVLDVLKFYDSKETVNNQKYMSFTSGDKSAHGYIAAHPSSTKTASEPP
LAPPVSEEEDEEEEEEEDDNEPPPVIAPRPEHTKSIYTRSVVESIASPAAPNKEVTPPSA
ENANSSTLYRNTDRQRKKSKMTDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTA
LDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYL
AGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTD
FGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNE
NPLRALYLIATNGTPELQNPERLSAVFRDFLNRCLEMDVDRRGSAKELLQVFLAGGNSLH
NYAIISMAFATLMLYWSKPLCL
NT seq 1689 nt   +upstreamnt  +downstreamnt
atgtctgacggtctggataatgaagagaaacccccagctcccccactgaggatgaatagt
aacaaccgggattcttcagcactcaaccacagctccaaaccacttcccatggcccctgaa
gagaagaataagaaagccaggcttcgctctatcttcccaggaggaggggataaaaccaat
aagaagaaggagaaagagcgcccagagatctctcttccttcagactttgagcatacgatt
catgtggggtttgatgcagtcaccggggaattcactccagatctctatggctcacagatg
tgcccagggaagctcccagagggaattcccgagcaatgggcacgattactccaaacctcc
aacataacaaaattggaacagaagaagaacccccaagctgttctagatgttctcaaattc
tatgattccaaagaaacagtcaacaaccagaaatacatgagctttacatcaggagataaa
agtgcacatggatacatagcagcccatccttcgagtacaaaaacagcatctgagcctcca
ttggcccctcctgtgtctgaagaagaagatgaagaggaggaagaagaagaagatgacaat
gagccaccaccagttatcgcaccaagaccagagcatacaaaatcaatctacactcgttct
gtggttgaatccattgcttcacctgcagcaccaaataaagaagtcacaccaccctctgct
gaaaatgccaattccagtactttgtacaggaacacagatcggcaaagaaaaaaatccaag
atgacagatgaggagatcttagagaagctaagaagcattgtgagtgttggggacccaaag
aaaaaatacacaagatttgaaaaaattggtcaaggggcatcaggtactgtttatacagca
ctagacattgcaacaggacaagaggtggccataaagcagatgaacctacaacagcaaccc
aagaaggaattaattattaatgaaattctggtcatgagggaaaataagaaccctaatatt
gttaattatttagatagctacttggtgggtgatgaactatgggtagtcatggaatacttg
gctggtggctctctgactgatgtggtcacagagacctgcatggatgaaggacagatagca
gctgtctgcagagagtgcctgcaagctttggatttcttgcactcaaaccaggtgatccat
agagatataaagagtgacaatattcttctcgggatggatggctctgttaaattgactgac
tttgggttctgtgcccagatcactcctgagcaaagtaaacgaagcactatggtgggaacc
ccatattggatggcacctgaggtggtgactcgaaaagcttatggtccgaaagttgatatc
tggtctctgggaattatggcaattgaaatggtggaaggtgaacccccttaccttaatgaa
aatccactcagggcattgtatctgatagccactaatggaaccccagagctccagaatcct
gagagactgtcggctgtattccgtgactttttaaatcgctgtcttgagatggatgtcgat
aggcgaggatctgccaaggagcttttgcaggtgttcttggccggaggtaattctctacat
aactatgcaattatttccatggcatttgctactctaatgctttactggtcaaagcccctt
tgcttgtga

KEGG   Macaca mulatta (rhesus monkey): 710314
Entry
710314            CDS       T01028                                 

Gene name
PAK2
Definition
(RefSeq) serine/threonine-protein kinase PAK 2
  KO
K04410  p21-activated kinase 2 [EC:2.7.11.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04010  MAPK signaling pathway
mcc04012  ErbB signaling pathway
mcc04014  Ras signaling pathway
mcc04360  Axon guidance
mcc04510  Focal adhesion
mcc04660  T cell receptor signaling pathway
mcc04810  Regulation of actin cytoskeleton
mcc05170  Human immunodeficiency virus 1 infection
mcc05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    710314 (PAK2)
   04012 ErbB signaling pathway
    710314 (PAK2)
   04014 Ras signaling pathway
    710314 (PAK2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    710314 (PAK2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    710314 (PAK2)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    710314 (PAK2)
  09158 Development and regeneration
   04360 Axon guidance
    710314 (PAK2)
 09160 Human Diseases
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    710314 (PAK2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    710314 (PAK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    710314 (PAK2)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     710314 (PAK2)
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: STE group
  STE20 family
   710314 (PAK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal APH Kdo zinc-ribbons_6
Other DBs
NCBI-GeneID: 710314
NCBI-ProteinID: NP_001252864
Ensembl: ENSMMUG00000012033
UniProt: F7GWI2 G7MKG9
LinkDB
Position
2
AA seq 524 aa
MSDNGELEDKPPAPPVRMSSTIFSTGGKDPLSANHSLKPLPSVPEEKKPRHKIISIFSGT
EKGSKKKEKERPEISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNP
QAVLDVLKFYDSNTVKQKYLSFTPPEKDGFPSGTPALNAKGTETPAVVTEEDDDDEETAP
PVIAPRPDHTKSIYTRSVIDPVPAPVGDSSVDGGAKSSDKQKKKTKMTDEEIMEKLRTIV
SIGDPKKKYTRYEKIGQGASGTVFTATDVALGQEVAIKQINLQKQPKKELIINEILVMKE
LKNPNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLH
ANQVIHRDIKSDNVLLGMEGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAY
GPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRC
LEMDVEKRGSAKELLQHPFLKLAKPLSSLTPLIMAAKEAMKSNR
NT seq 1575 nt   +upstreamnt  +downstreamnt
atgtctgataacggagaactggaagacaagcccccagcacctcctgtgcgaatgagcagc
accatctttagcactggaggcaaagaccccttgtcagccaatcacagtttgaaacctttg
ccctctgttccggaggagaagaagcccaggcacaaaatcatctccatattctcaggcaca
gagaaaggaagtaaaaagaaagaaaaggaacggccagaaatttctcctccatctgatttt
gaacacaccatccatgttggctttgatgctgttactggagaattcactggcatgccagaa
cagtgggctcgattactacagacctccaacatcaccaaactagagcaaaagaagaatcct
caggctgtgctggatgtcctcaagttctacgactccaacacagtgaagcagaagtatctg
agctttactcctccggagaaagatggcttcccttctggaacaccagcactgaacgccaag
ggaacagaaacacccgcagtagtgacagaggaagatgatgatgatgaagagactgctcct
cctgttattgccccacgaccagatcatacgaaatcaatttacacacggtctgtaattgac
cccgttcctgcaccagttggtgattcaagtgttgatggtggtgccaagtcttcagacaaa
cagaaaaagaagactaaaatgacagatgaagaaattatggagaaattaagaactattgtg
agcataggtgaccctaagaaaaaatatacaagatatgaaaaaattggacaaggggcttct
ggtacagttttcactgctactgacgttgcattgggacaggaggttgctatcaaacagatt
aatttacagaaacagccaaagaaggaattgatcattaatgagattctggtgatgaaagaa
ttaaaaaatcccaacatagttaacttcttggacagttacctggtaggagatgaattgttt
gtggtcatggaataccttgctggtggatcgctcactgatgtggtaacagaaacctgcatg
gatgaagcacagattgctgctgtatgcagagagtgcttgcaggcgttggagtttttacat
gctaatcaagtgatccacagagacatcaaaagcgacaatgtccttttgggaatggaagga
tcggttaagctcactgactttggtttctgtgcccagatcacccccgagcagagcaaacgc
agtaccatggtcggaaccccatactggatggcaccagaggtggttacacggaaagcttat
ggccccaaagtcgacatatggtctctgggtatcatggctattgagatggtagaaggagag
cctccatacctcaatgaaaatcccttgagggccttgtacctaatagcaactaatggaacc
ccagagcttcagaatccagagaaactttccccaatatttcgagatttcttaaatcgatgt
ttggaaatggatgtggaaaaaaggggttcagccaaagaattattacagcatcctttcttg
aaactggccaaaccattatctagcttgacaccactgatcatggcagctaaagaagcgatg
aagagtaaccgttaa

KEGG   Macaca mulatta (rhesus monkey): 719458
Entry
719458            CDS       T01028                                 

Gene name
PAK5
Definition
(RefSeq) serine/threonine-protein kinase PAK 7
  KO
K05736  p21-activated kinase 5 [EC:2.7.11.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04012  ErbB signaling pathway
mcc04014  Ras signaling pathway
mcc04360  Axon guidance
mcc04510  Focal adhesion
mcc04660  T cell receptor signaling pathway
mcc04810  Regulation of actin cytoskeleton
mcc05170  Human immunodeficiency virus 1 infection
mcc05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    719458 (PAK5)
   04014 Ras signaling pathway
    719458 (PAK5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    719458 (PAK5)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    719458 (PAK5)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    719458 (PAK5)
  09158 Development and regeneration
   04360 Axon guidance
    719458 (PAK5)
 09160 Human Diseases
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    719458 (PAK5)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    719458 (PAK5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    719458 (PAK5)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     719458 (PAK5)
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: STE group
  STE20 family
   719458 (PAK5)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal
Other DBs
NCBI-GeneID: 719458
NCBI-ProteinID: NP_001247916
Ensembl: ENSMMUG00000003275
UniProt: F7FKL1 G7N2Y5
LinkDB
Position
10
AA seq 719 aa
MFGKKKKKIEISGPSNFEHRVHTGFDPQEQKFTGLPQQWHSLLADTANRPKPMVDPSCIT
PIQLAPMKTIVRGNKPCKETSINGLLEDFDNISVTRSNSLRKESPPTPDQGASSHGPGHA
EENGFITFSQYSSESDTTADYTTEKYREKSLYGDDLDPYYRGSHAAKQNGHVMKMKHGEA
YYSEMKPLKSDFARFSADYHSHLDSLSKPSEYSDLKWEYQRASSSSPLDYSFQFTPSRTA
GTSGCSKESLAYSESEWGPSLDDYDRRPKSSYLNQTSPQPAMRQRSRSGSGLQEPMMPFG
ASAFKTHPQGHSYNSYTYPRLSEPTMCIPKVDYDRAQMVLSPPLSGSDTYPRGPAKLPQS
QSKAGYSSSSHQYPSGYHKATLYHHPSLQSSSQYISTASYLSSLSLSSSTYPPPSWGSSS
DQQPSRVSHEQFRAALQLVVSPGDPREYLDNFIKIGEGSTGIVCIATEKHTGKQVAVKKM
DLRKQQRRELLFNEVVIMRDYHHDNVVDMYNSYLVGDELWVVMEFLEGGALTDIVTHTRM
NEEQIATVCLSVLRALSYLHNQGVIHRDIKSDSILLTSDGRIKLSDFGFCAQVSKEVPKR
KSLVGTPYWMAPEVISRLPYGTEVDIWSLGIMVIEMIDGEPPYFNEPPLQAMRRIRDSLP
PRVKDLHKVSSVLRGFLDLMLVREPSQRATAQELLGHPFLKLAGPPSCIVPLMRQYRHH
NT seq 2160 nt   +upstreamnt  +downstreamnt
atgtttgggaagaaaaagaaaaagattgaaatatctggcccatccaactttgaacacagg
gttcacactgggtttgatccacaagagcagaagtttactggccttccccagcaatggcac
agcctgttagcagatacggccaacaggccaaagcctatggtggatccttcatgcatcaca
cccatccagctggctcctatgaagacaatcgttagaggaaacaaaccctgcaaggaaacc
tccatcaacggcctgctagaggattttgacaacatctcggtgactcgttccaactcccta
aggaaagaaagcccacccaccccagatcagggagcctccagccacggtccaggccacgcg
gaagaaaatggcttcatcaccttctcccagtattccagcgaatccgatactactgctgac
tacaccaccgaaaagtacagggagaagagtctctatggagacgatctggatccgtattat
agaggcagccatgcagccaaacaaaatgggcacgtaatgaaaatgaagcacggggaggcc
tactattctgagatgaagcctttgaaatccgatttcgccagattttctgctgattatcac
tcacatttggactcactgagcaaaccaagtgaatatagtgacctcaagtgggagtatcag
agagcctcgagtagctcccctctggattattcattccaattcacaccttctagaactgca
gggaccagcgggtgctccaaggagagcttggcatacagtgaaagtgaatggggacccagc
ctggatgactatgacaggaggccgaagtcttcgtacctgaatcagacgagcccccagccc
gccatgcggcagaggtccaggtcaggctcggggctccaggaaccgatgatgccatttgga
gcaagtgcatttaaaacccatccccaaggacactcctacaactcctacacctaccctcgc
ttgtccgagcccacaatgtgcattccaaaggtggattatgatcgagcacagatggtcctc
agccctccactgtcagggtctgacacctaccccaggggccctgccaaactacctcaaagt
caaagcaaagcgggctattcctcaagcagccaccagtatccgtctgggtaccacaaagcc
accttgtaccaccacccctccctgcagagcagttcgcagtacatctccaccgcttcctac
ctgagctccctcagcctctcatccagcacctacccgccgcccagctggggctcctcctcc
gaccagcagccctccagggtgtcccatgaacagtttcgggcggccctgcagctggtggtc
agcccaggagaccccagggaatacttggacaactttatcaaaatcggggaaggctcaacc
ggcatcgtgtgcatcgccaccgagaaacacacagggaaacaagttgcagtgaagaaaatg
gacctccggaagcaacagagacgggaactgcttttcaatgaggtcgtgatcatgcgggat
taccaccatgacaatgtggttgacatgtacaacagctaccttgttggcgatgagctctgg
gtggtcatggagtttctagaaggtggtgccttgacagacattgtgactcacaccagaatg
aatgaagaacagatagctactgtctgtctgtcagttctgagagctctctcctaccttcat
aaccaaggagtgattcacagggacataaaaagtgactccatcctcctgacaagtgatggc
cggatcaagttatctgattttggtttctgtgctcaagtttccaaagaggtgccgaagagg
aaatcattggttggcactccctactggatggcccctgaggtgatttctaggctaccttat
gggacagaggtggacatctggtcccttgggatcatggtgatagaaatgatcgatggtgag
cccccctacttcaacgagcctcccctccaggcaatgcggaggatccgggacagtttacct
ccaagagtgaaggacctacacaaggtttcttcagtgctccggggattcctagacctgatg
ttggtgagggagccctctcagagagcaacagcccaggaactcctcggacatccattctta
aaactagcaggtccaccgtcttgcatcgtccccctcatgagacaatacaggcatcactga

DBGET integrated database retrieval system