KEGG   Macaca mulatta (rhesus monkey): 696765
Entry
696765            CDS       T01028                                 

Gene name
ATG12
Definition
(RefSeq) LOW QUALITY PROTEIN: ubiquitin-like protein ATG12
  KO
K08336  ubiquitin-like protein ATG12
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04068  FoxO signaling pathway
mcc04136  Autophagy - other
mcc04140  Autophagy - animal
mcc04621  NOD-like receptor signaling pathway
mcc04622  RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    696765 (ATG12)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    696765 (ATG12)
   04136 Autophagy - other
    696765 (ATG12)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    696765 (ATG12)
   04622 RIG-I-like receptor signaling pathway
    696765 (ATG12)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    696765 (ATG12)
   04121 Ubiquitin system [BR:mcc04121]
    696765 (ATG12)
   03029 Mitochondrial biogenesis [BR:mcc03029]
    696765 (ATG12)
Membrane trafficking [BR:mcc04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    696765 (ATG12)
Ubiquitin system [BR:mcc04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   696765 (ATG12)
Mitochondrial biogenesis [BR:mcc03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    696765 (ATG12)
SSDB
Motif
Pfam: APG12 Atg8
Other DBs
NCBI-GeneID: 696765
NCBI-ProteinID: XP_014996100
LinkDB
Position
6
AA seq 187 aa
MTCQEHQVSLWNWVPRLRRLLCYALWRKARPLHALNRYFRSPISPSKMAEEPQSMLQLPP
SSAAGGEGPTEVSPETTTPEPPSSAAVSPGTEEPAGDTKKKIDILLKAVGDTPIMKTKKW
AVERTRTIQGLIDFIKKFLKLVASEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHY
CKSQAWG
NT seq 564 nt   +upstreamnt  +downstreamnt
atgacttgccaggaacaccaagtttcactgtggaattgggttccccgtctccggcgcctc
ctttgctacgctctctggagaaaagcacgcccactgcacgcgctcaatcgctacttccgc
tctccaatctctccaagcaagatggcggaggagccgcagtccatgttgcagcttcctccc
tcaagtgctgcgggaggggaaggacctacggaggtctccccagaaacaaccaccccggag
cccccgtcttccgctgcagtttccccgggaacagaggaacctgctggcgacaccaagaaa
aaaattgacattttgctaaaggctgtgggagatactcctattatgaaaacaaagaagtgg
gcggtagagcgaactcgaaccatccaaggactcattgacttcatcaaaaagtttctaaaa
cttgtggcctcagaacagttgtttatttatgtgaatcagtcctttgctccttccccagac
caagaagttggaactctgtatgagtgttttggcagtgatggtaaactggttttacattac
tgcaagtctcaggcatggggatga

DBGET integrated database retrieval system