KEGG   Macaca mulatta (rhesus monkey): 696797
Entry
696797            CDS       T01028                                 

Gene name
NR4A1
Definition
(RefSeq) nuclear receptor subfamily 4 group A member 1 isoform X2
  KO
K04465  nuclear receptor subfamily 4 group A member 1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04010  MAPK signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04925  Aldosterone synthesis and secretion
mcc04927  Cortisol synthesis and secretion
mcc04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    696797 (NR4A1)
   04151 PI3K-Akt signaling pathway
    696797 (NR4A1)
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    696797 (NR4A1)
   04927 Cortisol synthesis and secretion
    696797 (NR4A1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    696797 (NR4A1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcc03000]
    696797 (NR4A1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:mcc03310]
    696797 (NR4A1)
Transcription factors [BR:mcc03000]
 Eukaryotic type
  Zinc finger
   Cys4 nerve growth factor IB-like
    696797 (NR4A1)
Nuclear receptors [BR:mcc03310]
 4. Nerve growth factor IB like
  4A. Nerve growth factor IB like receptor
   696797 (NR4A1)
SSDB
Motif
Pfam: Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 696797
NCBI-ProteinID: XP_002798634
Ensembl: ENSMMUG00000022922
UniProt: F7HG84
LinkDB
Position
11
AA seq 598 aa
MPCIQAQYGTPAPSPGPRDHLASDPLTPEFIKPTMDLASPEAAPAAPTALPSFSTFMDGY
TGEFDTFLYQLPGTVQPCSSASSSASSTSSSSATSPASASFKFEDFQVYGCYPGPLSGPV
DEALSSSGSDYYGSPCSAPSPSTPSFQPPQLSPWDGSFGHFSPSQTYEGLRAWTEQLPKA
SGPPQPPAFFSFSPPTGPSPSLAQSPLKLFPSQATHQLGEGESYSMPTAFPGLAPTSPHL
EGSGILDAPVTSTKTRSGAPGGTEGRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKNAK
YICLANKDCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKQPPDAS
PANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPRFGKEDAGDVQQFYDLLSGSLEVIRKW
AEKIPGFAELSPADQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFG
DWIDSILAFSRSLHSLVVDVPAFACLSALVLITDRHGLQEPRRVEELQNRIASCLKEHVA
AVAGEPQPASCLSRLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPPIIDKIFMDTLPF
NT seq 1797 nt   +upstreamnt  +downstreamnt
atgccctgtatccaagcccaatatgggacaccagcaccgagtccaggaccccgtgaccac
ctggcaagcgaccccctgacccctgagttcatcaagcccaccatggacctggccagccct
gaggcggcccccgctgcccccactgccctgcccagcttcagcaccttcatggacggctac
acaggagagtttgacaccttcctctaccagctgccgggaacagtccagccatgctcctca
gcctcctcctcagcctcctccacatcctcgtcctcagccacctcccctgcctctgcctcc
ttcaaattcgaggacttccaggtgtacggctgctaccccggccccctgagcggcccagtg
gatgaggccctgtcctccagtggctctgactactatggcagcccctgctcggccccatca
ccgtccacgcccagcttccagccgccccagctctctccctgggatggctcattcggccac
ttctcgcccagccagacttacgaaggcctgcgggcatggacagagcagctgcccaaagcg
tctgggcccccacagcctccagccttcttttccttcagtcctcccaccggtcccagcccc
agcctggcccagagccccctgaagttgttcccctcacaggccacccaccagctgggggag
ggagagagctattccatgccaacagccttcccaggtttggcacccacttctccacacctt
gagggctcggggatactggatgcacccgtgacctcaaccaagacccggagcggggcccca
ggtggaactgaaggccgctgtgctgtgtgtggggacaacgcgtcatgccagcattatggt
gtccgcacctgcgagggctgcaagggcttcttcaagcgcacagtgcagaaaaacgccaag
tacatctgcctggctaacaaggactgccctgtggacaagaggcggcgaaaccgctgccag
ttctgccgcttccagaagtgcctggcggtgggcatggtgaaggaagttgtccgaacagac
agcctgaaggggcggcggggccggctaccttcaaaacccaagcagcctccagatgcctcc
cctgccaatctcctcacttccctggtccgtgcacacctggactcagggcccagcactgcc
aaactggactactccaagtttcaggagctggtgctgccccgctttgggaaggaagatgct
ggggatgtacagcagttctacgacctgctctccggttctctggaggtcatccgcaagtgg
gcggagaagatccctggctttgctgagctgtcaccagctgaccaggacctgttgctggag
tcagccttcctggagctcttcatcctccgcctggcatacaggtctaagccaggagagggc
aagctcatcttctgctcaggcctggtgctacaccggctgcagtgtgcccgtggcttcggc
gactggattgacagcatcctggccttctcaaggtccctgcacagcttggttgtcgatgtc
cctgccttcgcctgcctctctgctcttgtcctcatcaccgaccggcatgggctgcaggag
ccgcggcgggtggaggagctgcagaaccgcatcgccagctgcttgaaggagcacgtggca
gctgtggcgggcgagccccagccggccagctgcctgtcacgtctgttgggcaaactgccc
gagctccggaccctgtgcacccagggcctgcagcgtatattctacctcaagttggaggac
ttggtgccccctccacccatcatcgacaagatcttcatggacacgctgcccttctga

DBGET integrated database retrieval system