KEGG   Macaca mulatta (rhesus monkey): 696874
Entry
696874            CDS       T01028                                 

Gene name
ATG5
Definition
(RefSeq) autophagy protein 5 isoform X1
  KO
K08339  autophagy-related protein 5
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04136  Autophagy - other
mcc04137  Mitophagy - animal
mcc04140  Autophagy - animal
mcc04211  Longevity regulating pathway
mcc04213  Longevity regulating pathway - multiple species
mcc04216  Ferroptosis
mcc04621  NOD-like receptor signaling pathway
mcc04622  RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    696874 (ATG5)
   04136 Autophagy - other
    696874 (ATG5)
   04137 Mitophagy - animal
    696874 (ATG5)
  09143 Cell growth and death
   04216 Ferroptosis
    696874 (ATG5)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    696874 (ATG5)
   04622 RIG-I-like receptor signaling pathway
    696874 (ATG5)
  09149 Aging
   04211 Longevity regulating pathway
    696874 (ATG5)
   04213 Longevity regulating pathway - multiple species
    696874 (ATG5)
Membrane trafficking [BR:mcc04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    696874 (ATG5)
Mitochondrial biogenesis [BR:mcc03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    696874 (ATG5)
SSDB
Motif
Pfam: APG5
Other DBs
NCBI-GeneID: 696874
NCBI-ProteinID: XP_001088300
Ensembl: ENSMMUG00000019679
UniProt: A0A5F7ZYF8 G7MQ04
LinkDB
Position
4
AA seq 275 aa
MTDDKDVLRDVWFGRIPTCFTLYQDEITEREAEPYYLLLPRVSYLTLVTDKVKKHFQKVM
RQEDISEIWFEYEGTPLKWHYPIGLLFDLLASSSALPWNITVHFKSFPEKDLLHCPSKDA
IEAHFMSCMKEADALKHKSQVINEMQKKDHKQLWMGLQNDRFDQFWAINRKLMEYPAEEN
GFRYIPFRIYQTTTERPFIQKLFRPVAADGQLHTLGDLLKEVCPSAIDPEDGEKKNQVMI
HGIEPMLETPLQWLSEHLSYPDNFLHISIIPQPTD
NT seq 828 nt   +upstreamnt  +downstreamnt
atgacagatgacaaagatgtgcttcgagatgtgtggtttggacgtattccaacttgcttc
acgctatatcaggatgagataactgaaagggaagcagaaccatactatttgcttttgcca
agagtaagttatttgacgttggtaactgacaaagtgaaaaagcactttcagaaggttatg
agacaagaagacattagtgagatatggtttgaatatgaaggcacaccactgaaatggcat
tatccaattggtttactatttgatcttcttgcatcaagttcagctcttccttggaacatc
acagtacattttaagagttttccagaaaaagaccttctgcactgtccatctaaggatgca
attgaagctcattttatgtcatgtatgaaagaagctgatgctttaaaacataaaagtcaa
gtaatcaatgaaatgcagaaaaaagatcacaagcaactctggatgggattacaaaatgac
agatttgaccagttttgggccatcaatcggaaactcatggaatatcctgcagaagaaaat
ggatttcgttatatcccctttagaatatatcagacaacgactgaaagacctttcattcag
aagctctttcgtcctgtggctgcagatggacagttgcacacactaggagatcttctcaaa
gaagtttgtccttctgctattgatcctgaagatggggaaaaaaagaatcaagtgatgatt
catggaattgagccaatgttggaaacgcctctgcagtggctgagtgaacatctgagctac
ccggataattttcttcatattagtatcatcccgcagccaacagattga

DBGET integrated database retrieval system