KEGG   Macaca mulatta (rhesus monkey): 697069
Entry
697069            CDS       T01028                                 

Gene name
PLCG1
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 isoform X1
  KO
K01116  phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00562  Inositol phosphate metabolism
mcc01100  Metabolic pathways
mcc01521  EGFR tyrosine kinase inhibitor resistance
mcc04012  ErbB signaling pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04020  Calcium signaling pathway
mcc04062  Chemokine signaling pathway
mcc04064  NF-kappa B signaling pathway
mcc04066  HIF-1 signaling pathway
mcc04070  Phosphatidylinositol signaling system
mcc04072  Phospholipase D signaling pathway
mcc04360  Axon guidance
mcc04370  VEGF signaling pathway
mcc04613  Neutrophil extracellular trap formation
mcc04650  Natural killer cell mediated cytotoxicity
mcc04658  Th1 and Th2 cell differentiation
mcc04659  Th17 cell differentiation
mcc04660  T cell receptor signaling pathway
mcc04664  Fc epsilon RI signaling pathway
mcc04666  Fc gamma R-mediated phagocytosis
mcc04670  Leukocyte transendothelial migration
mcc04722  Neurotrophin signaling pathway
mcc04750  Inflammatory mediator regulation of TRP channels
mcc04919  Thyroid hormone signaling pathway
mcc04933  AGE-RAGE signaling pathway in diabetic complications
mcc04935  Growth hormone synthesis, secretion and action
mcc05012  Parkinson disease
mcc05022  Pathways of neurodegeneration - multiple diseases
mcc05135  Yersinia infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05171  Coronavirus disease - COVID-19
mcc05200  Pathways in cancer
mcc05205  Proteoglycans in cancer
mcc05206  MicroRNAs in cancer
mcc05214  Glioma
mcc05223  Non-small cell lung cancer
mcc05225  Hepatocellular carcinoma
mcc05231  Choline metabolism in cancer
mcc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Module
mcc_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    697069 (PLCG1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    697069 (PLCG1)
   04014 Ras signaling pathway
    697069 (PLCG1)
   04015 Rap1 signaling pathway
    697069 (PLCG1)
   04370 VEGF signaling pathway
    697069 (PLCG1)
   04064 NF-kappa B signaling pathway
    697069 (PLCG1)
   04066 HIF-1 signaling pathway
    697069 (PLCG1)
   04020 Calcium signaling pathway
    697069 (PLCG1)
   04070 Phosphatidylinositol signaling system
    697069 (PLCG1)
   04072 Phospholipase D signaling pathway
    697069 (PLCG1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    697069 (PLCG1)
   04650 Natural killer cell mediated cytotoxicity
    697069 (PLCG1)
   04660 T cell receptor signaling pathway
    697069 (PLCG1)
   04658 Th1 and Th2 cell differentiation
    697069 (PLCG1)
   04659 Th17 cell differentiation
    697069 (PLCG1)
   04664 Fc epsilon RI signaling pathway
    697069 (PLCG1)
   04666 Fc gamma R-mediated phagocytosis
    697069 (PLCG1)
   04670 Leukocyte transendothelial migration
    697069 (PLCG1)
   04062 Chemokine signaling pathway
    697069 (PLCG1)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    697069 (PLCG1)
   04919 Thyroid hormone signaling pathway
    697069 (PLCG1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    697069 (PLCG1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    697069 (PLCG1)
  09158 Development and regeneration
   04360 Axon guidance
    697069 (PLCG1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    697069 (PLCG1)
   05206 MicroRNAs in cancer
    697069 (PLCG1)
   05205 Proteoglycans in cancer
    697069 (PLCG1)
   05231 Choline metabolism in cancer
    697069 (PLCG1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    697069 (PLCG1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    697069 (PLCG1)
   05214 Glioma
    697069 (PLCG1)
   05223 Non-small cell lung cancer
    697069 (PLCG1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    697069 (PLCG1)
   05022 Pathways of neurodegeneration - multiple diseases
    697069 (PLCG1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    697069 (PLCG1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    697069 (PLCG1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    697069 (PLCG1)
   05171 Coronavirus disease - COVID-19
    697069 (PLCG1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    697069 (PLCG1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    697069 (PLCG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    697069 (PLCG1)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     697069 (PLCG1)
Membrane trafficking [BR:mcc04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    697069 (PLCG1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    697069 (PLCG1)
SSDB
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y C2 SH3_1 PH SH3_9 SH3_2 PH_12 GDPD PH_9
Other DBs
NCBI-GeneID: 697069
NCBI-ProteinID: XP_015004490
Ensembl: ENSMMUG00000005905
UniProt: A0A1D5R8E9
LinkDB
Position
10
AA seq 1291 aa
MAGAASPCANGCGPGAPSDAEVLHLCRSLEVGTVMTLFYSKKSQRPERKTFQVKLETRQI
TWSRGADKIEGAIDIREIKEIRPGKTSRDFDRYQEDPAFRPDQSHCFVILYGMEFRLKTL
SLQATSEDEVNMWIKGLTWLMEDTLQAPTPLQIERWLRKQFYSVDRNREDRISAKDLKNM
LSQVNYRVPNMRFLRERLTDLEQRSGDITYGQFAQLYRSLMYSAQKTMDLPFLEASTLRA
GERPELCRVSLPEFQQFLLDYQGELWAVDRLQVQEFMLSFLRDPLREIEEPYFFLDEFVT
FLFSKENSVWNSQLDAVCPDTMNNPLSHYWISSSHNTYLTGDQFSSESSLEAYARCLRMG
CRCIELDCWDGPDGMPVIYHGHTLTTKIKFSDVLQTIKEHAFVASEYPVILSIEDHCSIA
QQRNMAQHFKKVLGDTLLTKPVEISADGLPSPNQLKRKILIKHKKLAEGSAYEEVPTSMM
YSENDISNSIKNGILYLEDPVNHEWYPHYFVLTSSKIYYSEETSSDQGNEDEEEPKEVSS
STELHSNEKWFHGKLGAGRDGRHIAERLLTEYCIETGAPDGSFLVRESETFVGDYTLSFW
RNGKVQHCRIHSRQDAGTPKFFLTDNLVFDSLYDLITHYQQVPLRCNEFEMRLSEPVPQT
NAHESKEWYHASLTRAQAEHMLMRVPRDGAFLVRKRNEPNSYAISFRAEGKIKHCRVQQE
GQTVMLGNSEFDSLVDLISYYEKHPLYRKMKLRYPINEEALEKIGTAEPDYGALYEGRNP
GFYVEANPMPTFKCAVKALFDYKAQREDELTFTKSAIIQNVEKQEGGWWRGDYGGKKQLW
FPSNYVEEMVNPVALEPEREHLDENSPLGDLLRGVLDVPACQIAIRPEGKNNRLFVFSIS
MASVAHWSLDVAADSQEELQDWVKKIREVAQTADARLTEGKIMERRKKIALELSELVVYC
RPVPFDEEKIGTERACYRDMSSFPETKAEKYVNKAKGKKFLQYNRLQLSRIYPKGQRLDS
SNYDPLPMWICGSQLVALNFQTPDKPMQMNQALFMTGRHCGYVLQPSTMRDEAFDPFDKS
SLRGLEPCAISVEVLGARHLPKNGRGIVCPFVEIEVAGAEYDSTKQKTEFVVDNGLNPVW
PAKPFHFQISNPEFAFLRFVVYEEDMFSDQNFLAQATFPVKGLKTGYRAVPLKNNYSEDL
ELASLLIKIDIFPAKQENGDLSPFSGTSLRERGSDASGQLFHGRAREGSFESRYQQPFED
FRVSQEHLADHFDSRERRAPRRTRVNGDNRL
NT seq 3876 nt   +upstreamnt  +downstreamnt
atggcgggcgccgcatccccctgcgccaacggctgcgggcccggcgcgccctcggacgcc
gaggtgctgcacctctgccgcagcctcgaggtgggcaccgtcatgactttgttctactcc
aagaagtcgcagcgacccgagcggaagaccttccaggtcaagctggagacgcgccagatc
acgtggagccggggcgccgacaagatagagggggccattgatattcgagaaatcaaggag
attcgcccagggaagacctcacgagactttgatcgctatcaagaggaccccgctttccgg
ccggaccagtcacactgctttgtcattctctatggaatggaattccgtctgaagacgctg
agcctgcaagccacatctgaggatgaagtgaacatgtggatcaagggcttaacttggctg
atggaggatacattgcaggcacccacacccctgcagattgagaggtggctccggaagcag
ttttactcagtggatcggaatcgtgaggatcgtatatcagccaaggacctaaagaacatg
ctgtcccaggtcaactaccgggtccccaacatgcgcttcctccgagagcggctaacggac
ctggagcagcgcagcggggacatcacctacgggcagtttgctcagctgtaccgcagcctc
atgtacagcgcccagaagacgatggacctccccttcttggaagccagtactctgagggct
ggggagcggccggagctttgccgagtgtcccttcctgagttccagcagttccttcttgac
taccagggggagctgtgggctgttgatcgcctccaggtgcaggagttcatgctcagcttc
ctccgagaccccttgcgagagatcgaggagccatacttcttcctggatgagtttgtcacc
ttcctgttctccaaagagaatagtgtgtggaactcacagctggatgcagtatgcccggac
accatgaacaaccccctttcccactattggatctcctcctcacacaacacgtacctgacc
ggggaccagttctccagtgagtcctccttggaagcctatgctcgctgcctgcggatgggc
tgtcgctgcattgagttggactgctgggacggcccagatgggatgccagttatttaccat
gggcacacccttaccaccaagatcaagttctcagatgtcctgcaaaccatcaaggagcat
gcctttgtggcctcagagtacccagtcatcctgtccattgaggaccactgcagcattgcc
cagcagaggaacatggcccagcacttcaagaaggtgctaggggacacactcctcaccaag
cccgtggagatctccgccgatgggctcccctcacccaaccagcttaagaggaagatcctc
atcaagcacaagaagctggctgagggcagtgcctacgaggaggtgcctacatccatgatg
tactctgagaacgacatcagcaactccatcaagaatggcatcctctacctggaggaccct
gtgaaccatgaatggtatccccactacttcgttctgaccagcagcaagatctactactct
gaggagaccagcagtgaccagggcaacgaggatgaggaggagcccaaggaggtcagcagc
agcacagagctgcactccaatgagaagtggttccatgggaagctaggggcagggcgtgac
gggcggcacatcgctgagcgcctgctcactgagtactgcatcgagaccggggcccctgac
ggctccttcctcgtgcgagagagtgagaccttcgtgggcgactacacgctctctttctgg
cggaacgggaaagtccagcactgccgtatccactcacggcaagatgctgggacccccaag
ttcttcttgacagacaacctcgtctttgactccctctatgacctcatcacacactaccag
caggtgcccctgcgctgcaatgagtttgagatgcgactttcagagcctgtcccacagacc
aatgcccatgagagcaaagagtggtaccacgcgagcctgaccagagcacaggctgagcac
atgctgatgcgtgtccctcgtgatggggccttcctggtgcggaagcggaatgagcccaac
tcatatgccatctctttccgggctgaaggcaagatcaagcattgccgtgtccagcaagag
ggccagactgtgatgctagggaactcggagttcgacagccttgttgacctcatcagctac
tatgagaagcacccgctataccgcaagatgaagctgcgctatccaatcaatgaggaggcg
ctggagaagattggcacagctgagcctgactacggggccctgtatgagggacgcaaccct
ggcttctatgtagaggcaaaccctatgccaactttcaagtgtgcagtcaaagccctcttt
gactacaaggcccagagggaggatgagctgaccttcaccaagagcgccatcatccagaat
gtggagaagcaagagggaggctggtggcgaggggactacggagggaagaagcagctgtgg
ttcccatcaaactacgtggaagagatggtcaaccccgtggccctggagccagagagggag
cacttggacgagaacagccccctaggggacttgctgcggggggtcttggatgtgccggct
tgtcagattgccatccgtcctgagggcaagaacaaccggctcttcgtcttctccatcagc
atggcgtcggtggcccactggtccctggatgttgctgccgactcacaggaggagctgcag
gactgggtgaaaaagatccgtgaagtggcccagaccgcagatgccaggctcactgaaggg
aagataatggaacggaggaagaagatcgccctggagctctctgaacttgttgtctactgc
cggcctgttcccttcgatgaagagaagattggcacagaacgtgcttgctaccgggacatg
tcatccttcccggaaaccaaggctgagaaatacgtgaacaaggccaaaggcaagaagttc
cttcagtacaatcgactgcagctctcccgcatctaccccaagggccagcgactggattcc
tccaactacgatcctttgcccatgtggatctgtggcagtcagctggtggccctcaacttc
cagacccctgacaagcctatgcagatgaaccaggctctcttcatgacgggcaggcactgt
ggctacgtgctgcagccaagcaccatgcgggatgaggccttcgacccctttgacaagagc
agcctccgcgggctggagccatgtgccatctctgttgaggtgctgggtgcccgacatttg
ccaaagaatggccgaggcattgtgtgcccttttgtggagattgaggtggctggagctgag
tatgacagcaccaagcagaagacagagtttgtggtggacaatggactcaaccctgtatgg
ccggccaagcccttccacttccagatcagtaaccctgaatttgcctttctgcgctttgtg
gtgtatgaggaagacatgtttagtgaccagaatttcctggctcaggctactttcccggta
aaaggcctgaagacaggatacagagcagtgcctttgaagaacaactacagtgaggacctg
gagttggcctccctgctgatcaagattgacattttccctgccaagcaggagaatggtgac
ctcagtcccttcagtggtacgtccctgcgggagcggggctcagatgcctcaggccagctg
tttcacggccgagcccgggaaggctcctttgaatcccgctaccagcagccatttgaggac
ttccgcgtctcccaggagcatcttgcagaccattttgacagtcgagaacgaagggcccca
agaaggactcgggtcaatggagacaaccgcctctag

DBGET integrated database retrieval system