KEGG   Macaca mulatta (rhesus monkey): 697082
Entry
697082            CDS       T01028                                 

Gene name
BCL2L11
Definition
(RefSeq) bcl-2-like protein 11 isoform X1
  KO
K16341  Bcl-2-like protein 11
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01521  EGFR tyrosine kinase inhibitor resistance
mcc04068  FoxO signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04210  Apoptosis
mcc04215  Apoptosis - multiple species
mcc04932  Non-alcoholic fatty liver disease
mcc05169  Epstein-Barr virus infection
mcc05200  Pathways in cancer
mcc05206  MicroRNAs in cancer
mcc05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    697082 (BCL2L11)
   04151 PI3K-Akt signaling pathway
    697082 (BCL2L11)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    697082 (BCL2L11)
   04215 Apoptosis - multiple species
    697082 (BCL2L11)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    697082 (BCL2L11)
   05206 MicroRNAs in cancer
    697082 (BCL2L11)
  09162 Cancer: specific types
   05210 Colorectal cancer
    697082 (BCL2L11)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    697082 (BCL2L11)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    697082 (BCL2L11)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    697082 (BCL2L11)
SSDB
Motif
Pfam: Bim_N Bclx_interact PMAIP1
Other DBs
NCBI-GeneID: 697082
NCBI-ProteinID: XP_014968605
UniProt: F7HHA7
LinkDB
Position
13
AA seq 292 aa
MFPAAAAGAARARGAACGALGCPAECGGGLAGRRGLCAAPGTLNPSPELCFLRCLRGDGQ
GAPGRRRARARRPGARARARTLRSEGKARTKKDQMAKQPSDVSSECDREGRQLQPAERPP
QLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS
SLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEI
RIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH
NT seq 879 nt   +upstreamnt  +downstreamnt
atgttcccggcggctgcggccggggcagcgcgggccagaggcgcggcgtgcggagccctc
ggctgcccggcggagtgcggcggcgggctggcgggtaggcgcgggctgtgcgctgcgccg
ggtactctgaacccaagtccagagctttgtttcctgcgctgccttcgtggtgacggtcag
ggggcgccgggtcggcgaagagcgcgggccagacgccccggggcccgggcgcgggcccgg
acgctacgctctgaagggaaggcgcggacaaaaaaagaccaaatggcaaagcaaccttct
gatgtaagttctgagtgtgaccgagaaggtagacaattgcagcctgcggagaggcctccc
cagctcagacctggggcccctacctccctacagacagagccacaaggtaatcccgaaggc
aatcacggaggtgaaggggacagctgcccccacggcagccctcagggcccgctggcccca
ccggccagccctggcccttttgctaccagatccccgcttttcatctttatgagaagatcc
tccctgctgtctcgatcctccagtgggtatttctcttttgacacagacaggagcccagca
cccatgagttgtgacaaatcaacacaaaccccaagtcctccttgccaggccttcaaccac
tatctcagtgcaatggcttccaggaggcaggctgaacctgcagatatgcgcccggagata
cggatcgcccaagagttgcggcgaatcggagacgagtttaacgcttactatgcaaggagg
gtatttttgaataattaccaagcagccgaagaccacccacaaatggttatcttacgactg
ttgcgttacattgtccgcctggtgtggagaatgcattga

DBGET integrated database retrieval system