KEGG   Macaca mulatta (rhesus monkey): 697188
Entry
697188            CDS       T01028                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01522  Endocrine resistance
mcc04012  ErbB signaling pathway
mcc04066  HIF-1 signaling pathway
mcc04068  FoxO signaling pathway
mcc04110  Cell cycle
mcc04151  PI3K-Akt signaling pathway
mcc04933  AGE-RAGE signaling pathway in diabetic complications
mcc04934  Cushing syndrome
mcc05162  Measles
mcc05165  Human papillomavirus infection
mcc05169  Epstein-Barr virus infection
mcc05200  Pathways in cancer
mcc05202  Transcriptional misregulation in cancer
mcc05203  Viral carcinogenesis
mcc05206  MicroRNAs in cancer
mcc05215  Prostate cancer
mcc05220  Chronic myeloid leukemia
mcc05222  Small cell lung cancer
mcc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    697188 (CDKN1B)
   04066 HIF-1 signaling pathway
    697188 (CDKN1B)
   04068 FoxO signaling pathway
    697188 (CDKN1B)
   04151 PI3K-Akt signaling pathway
    697188 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    697188 (CDKN1B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    697188 (CDKN1B)
   05202 Transcriptional misregulation in cancer
    697188 (CDKN1B)
   05206 MicroRNAs in cancer
    697188 (CDKN1B)
   05203 Viral carcinogenesis
    697188 (CDKN1B)
  09162 Cancer: specific types
   05226 Gastric cancer
    697188 (CDKN1B)
   05220 Chronic myeloid leukemia
    697188 (CDKN1B)
   05215 Prostate cancer
    697188 (CDKN1B)
   05222 Small cell lung cancer
    697188 (CDKN1B)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    697188 (CDKN1B)
   04934 Cushing syndrome
    697188 (CDKN1B)
  09172 Infectious disease: viral
   05162 Measles
    697188 (CDKN1B)
   05169 Epstein-Barr virus infection
    697188 (CDKN1B)
   05165 Human papillomavirus infection
    697188 (CDKN1B)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    697188 (CDKN1B)
SSDB
Motif
Pfam: CDI Multi-haem_cyto
Other DBs
NCBI-GeneID: 697188
NCBI-ProteinID: NP_001247934
Ensembl: ENSMMUG00000044308
UniProt: A0A1D5RC88 G7N683
LinkDB
Position
11
AA seq 198 aa
MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKW
NFDFQNHRPLEGKYEWQEVEKGSLPEFYYRPPRAPKGACKVPAQESQDVSGSRPAAPLIG
APANPEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATDDSSTQNKRANRTEENVSDGSPN
AGSVEQTPKKPGLRRRQT
NT seq 597 nt   +upstreamnt  +downstreamnt
atgtcaaacgtgcgagtgtctaacgggagccctagcctagagcggatggacgccaggcag
gcggagcaccccaagccctcggcctgcaggaacctcttcggcccggtggaccacgaagag
ttaacccgggacttggagaagcactgcagagacatggaagaggcgagccagcgcaagtgg
aatttcgattttcagaatcacagacccctagagggcaagtacgagtggcaagaggtggag
aagggcagcttgcctgagttctactatagacccccgcgggcccccaaaggcgcctgcaag
gtgccggcgcaggagagccaggatgtcagcgggagccgcccggcggcgcctttaattggg
gctccggctaaccctgaggacacgcatttggtagacccaaagactgatccgtcggacagc
cagacggggttagcggagcagtgcgcaggaataaggaagcgacctgcaaccgacgattct
tccactcaaaacaaaagagccaacagaacagaagaaaatgtttcagacggttccccaaat
gccggttctgtggagcagacgcccaagaagcctggcctcagaagacgtcaaacgtaa

DBGET integrated database retrieval system