KEGG   Macaca mulatta (rhesus monkey): 697523
Entry
697523            CDS       T01028                                 

Gene name
PDPK1
Definition
(RefSeq) 3-phosphoinositide-dependent protein kinase 1 isoform X2
  KO
K06276  3-phosphoinositide dependent protein kinase-1 [EC:2.7.11.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01524  Platinum drug resistance
mcc03320  PPAR signaling pathway
mcc04068  FoxO signaling pathway
mcc04071  Sphingolipid signaling pathway
mcc04140  Autophagy - animal
mcc04150  mTOR signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04152  AMPK signaling pathway
mcc04210  Apoptosis
mcc04510  Focal adhesion
mcc04660  T cell receptor signaling pathway
mcc04664  Fc epsilon RI signaling pathway
mcc04722  Neurotrophin signaling pathway
mcc04910  Insulin signaling pathway
mcc04919  Thyroid hormone signaling pathway
mcc04931  Insulin resistance
mcc04960  Aldosterone-regulated sodium reabsorption
mcc05145  Toxoplasmosis
mcc05205  Proteoglycans in cancer
mcc05213  Endometrial cancer
mcc05215  Prostate cancer
mcc05223  Non-small cell lung cancer
mcc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    697523 (PDPK1)
   04071 Sphingolipid signaling pathway
    697523 (PDPK1)
   04151 PI3K-Akt signaling pathway
    697523 (PDPK1)
   04152 AMPK signaling pathway
    697523 (PDPK1)
   04150 mTOR signaling pathway
    697523 (PDPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    697523 (PDPK1)
  09143 Cell growth and death
   04210 Apoptosis
    697523 (PDPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    697523 (PDPK1)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    697523 (PDPK1)
   04664 Fc epsilon RI signaling pathway
    697523 (PDPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    697523 (PDPK1)
   03320 PPAR signaling pathway
    697523 (PDPK1)
   04919 Thyroid hormone signaling pathway
    697523 (PDPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    697523 (PDPK1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    697523 (PDPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    697523 (PDPK1)
   05231 Choline metabolism in cancer
    697523 (PDPK1)
  09162 Cancer: specific types
   05215 Prostate cancer
    697523 (PDPK1)
   05213 Endometrial cancer
    697523 (PDPK1)
   05223 Non-small cell lung cancer
    697523 (PDPK1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    697523 (PDPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    697523 (PDPK1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    697523 (PDPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    697523 (PDPK1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    697523 (PDPK1)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     697523 (PDPK1)
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: AGC group
  PDK1 family
   697523 (PDPK1)
Membrane trafficking [BR:mcc04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    697523 (PDPK1)
SSDB
Motif
Pfam: Pkinase PH_3 PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal APH Kdo
Other DBs
NCBI-GeneID: 697523
NCBI-ProteinID: XP_014980874
Ensembl: ENSMMUG00000011459
UniProt: H9ESX9
LinkDB
Position
20
AA seq 556 aa
MARTTSQLYDAVPIQSSVVLCSCPSPSMVRTQTESSTAPGIPGGSRQGPTMDGTAAEPRP
GAGSLQHAQPPPQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIK
ENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDET
CTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARAN
SFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYD
FPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLTA
YLPAMSEDDEDCYGNYDNLLSQFGCMQLSLSSSSHSLSASDVGLPQRSGSNIEQYIHDLD
SNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLLTE
GPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCRKIQ
EVWRQRYQSHPDAAVQ
NT seq 1671 nt   +upstreamnt  +downstreamnt
atggccaggaccaccagccagctgtatgacgccgtgcccatccagtccagcgtggtgtta
tgttcctgcccatccccatcaatggtgaggacccagactgagtccagcacggcccctggc
attcctggtggtagcaggcagggccccaccatggacggcactgcagccgagcctcggccc
ggtgccggctccctgcagcacgcccagcctccgccgcagcctcggaagaagcggcctgag
gacttcaagtttgggaaaattcttggggaaggctctttttccacggttgtcctggctcga
gaactggcaacctccagagaatatgcgattaaaattctggagaagcgacatatcataaaa
gagaacaaagtcccgtatgtaaccagagagcgggatgtcatgtcgcgcctggatcacccc
ttctttgttaagctttacttcacgtttcaggacgacgagaagctgtatttcggccttagt
tatgccaaaaatggagaactacttaaatatattcgcaaaatcggttcatttgatgagacc
tgtactcgattttacacggctgagattgtgtctgctttagagtacttgcacggcaagggc
atcattcacagggaccttaaaccggaaaacattttgttaaatgaagatatgcacatccag
atcacagattttggaacagcaaaggtcttatccccagagagcaaacaagccagggccaac
tcattcgtgggaacagcgcagtacgtttctccagagctgctcacggagaagtccgcctgt
aagagttcagacctttgggctcttggatgcataatataccagcttgtggcaggactccca
ccattccgagctggaaatgagtatcttatatttcagaagatcattaagttggaatatgac
tttccagaaaaattcttccctaaggcaagagacctcgtggagaaacttttggttttagat
gccacaaagcggttaggctgtgaggaaatggaagggtatggacctcttaaagcacaccca
ttcttcgagtctgtcacgtgggagaacctgcaccagcagacgcctccgaagctcaccgct
tacctgccggccatgtcggaagacgacgaggactgctacggcaattatgacaatctcctg
agccagtttggctgcatgcagttgtccttgtcctcctcctcacactccttgtcagcctcg
gacgtgggcctgccccagaggtcaggcagcaacatagagcagtacatccatgatttggac
tcgaactcctttgaactggacttacagttttccgaagatgagaagaggttgttactggag
aagcaggctggcggaaacccttggcaccagtttgtagaaaataatttaatactaaagatg
ggcccggtggataagcggaagggtttattcgcacgacgacgacagttgttgctcacagaa
ggaccacatttatattacgtggatcctgtcaacaaagtcctgaaaggtgaaattccttgg
tcacaagaactccgaccagaggccaagaattttaaaacgttctttgtccacacgcctaac
aggacgtattatctgatggaccccagcgggaacgcacacaagtggtgcaggaagatccag
gaagtttggaggcagcgataccagagccacccagatgccgctgtgcagtga

DBGET integrated database retrieval system