KEGG   Macaca mulatta (rhesus monkey): 697573
Entry
697573            CDS       T01028                                 

Gene name
ERBB2
Definition
(RefSeq) receptor tyrosine-protein kinase erbB-2 isoform X1
  KO
K05083  receptor tyrosine-protein kinase erbB-2 [EC:2.7.10.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01521  EGFR tyrosine kinase inhibitor resistance
mcc01522  Endocrine resistance
mcc01524  Platinum drug resistance
mcc04010  MAPK signaling pathway
mcc04012  ErbB signaling pathway
mcc04020  Calcium signaling pathway
mcc04066  HIF-1 signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04510  Focal adhesion
mcc04520  Adherens junction
mcc04530  Tight junction
mcc05200  Pathways in cancer
mcc05205  Proteoglycans in cancer
mcc05206  MicroRNAs in cancer
mcc05212  Pancreatic cancer
mcc05213  Endometrial cancer
mcc05215  Prostate cancer
mcc05219  Bladder cancer
mcc05223  Non-small cell lung cancer
mcc05224  Breast cancer
mcc05226  Gastric cancer
mcc05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    697573 (ERBB2)
   04012 ErbB signaling pathway
    697573 (ERBB2)
   04066 HIF-1 signaling pathway
    697573 (ERBB2)
   04020 Calcium signaling pathway
    697573 (ERBB2)
   04151 PI3K-Akt signaling pathway
    697573 (ERBB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    697573 (ERBB2)
   04520 Adherens junction
    697573 (ERBB2)
   04530 Tight junction
    697573 (ERBB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    697573 (ERBB2)
   05206 MicroRNAs in cancer
    697573 (ERBB2)
   05205 Proteoglycans in cancer
    697573 (ERBB2)
   05230 Central carbon metabolism in cancer
    697573 (ERBB2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    697573 (ERBB2)
   05226 Gastric cancer
    697573 (ERBB2)
   05219 Bladder cancer
    697573 (ERBB2)
   05215 Prostate cancer
    697573 (ERBB2)
   05213 Endometrial cancer
    697573 (ERBB2)
   05224 Breast cancer
    697573 (ERBB2)
   05223 Non-small cell lung cancer
    697573 (ERBB2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    697573 (ERBB2)
   01524 Platinum drug resistance
    697573 (ERBB2)
   01522 Endocrine resistance
    697573 (ERBB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    697573 (ERBB2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    697573 (ERBB2)
   04090 CD molecules [BR:mcc04090]
    697573 (ERBB2)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     697573 (ERBB2)
Protein kinases [BR:mcc01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   697573 (ERBB2)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   697573 (ERBB2)
CD molecules [BR:mcc04090]
 Proteins
  697573 (ERBB2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH Kinase-like
Other DBs
NCBI-GeneID: 697573
NCBI-ProteinID: XP_001090430
Ensembl: ENSMMUG00000001348
LinkDB
Position
16
AA seq 1255 aa
MELAAWYRWGLLLALLPPGAAGTQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNL
ELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNYALAVLDNG
DLLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLA
LTLIDTNRSRACHPCSPVCKGSRCWGESSEDCQSLTRTVCAGGCARCKGPLPTDCCHEQC
AAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRYTFGASCVTACP
YNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCYGLGMEHLREVRAVTSAN
IQEFAGCKKIFGSLAFLPESFDGDPASNTAPLQPEQLRVFETLEEITGYLYISAWPDSLP
DLSVLQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALIHHNTRLCFVHTV
PWDQLFRNPHQALLHTANRPEDECVGEGLACHQLCARGHCWGPGPTQCVNCSQFLRGQEC
VEECRVLQGLPREYVNARHCLPCHPECQPQNGSVTCFGPEADQCVACAHYKDPPFCVARC
PSGVKPDLSYMPIWKFPDEEGTCQSCPINCTHSCVDLDDKGCPAEQRASPLTSIISAVVG
ILLVVVLGVVFGILIKRRQQKIRKYTMRRLLQETELVEPLTPSGAMPNQAQMRILKETEL
RKVKVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGVGSP
YVSRLLGICLTSTVQLVTQLMPYGCLLDHVRENRGRLGSQDLLNWCMQIAKGMSYLEDVR
LVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILRRRFT
HQSDVWSYGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVKCWM
IDSECRPRFRELVSEFSRMARDPQRFVVIQNEDLGPASPLDSTFYRSLLEDDDMGDLVDA
EEYLVPQQGFFCPDPAPGTGGMVHHRHRSSSTRSGGGDLTLGLEPSEEEAPRSPRAPSEG
TGSDVFDGDLGMGAAKGLQSLPAHDPSPLQRYSEDPTVPLPSETDGYVAPLTCSPQPEYV
NQPDVRPQPPSPQEGPLSPARPTGATLERPKTLSPGKNGVVKDVFAFGGAVENPEYLAPR
GGAAPQPHLPPAFSPAFDNLYYWDQDPSERGAPPSTFKGTPTAENPEYLGLDVPV
NT seq 3768 nt   +upstreamnt  +downstreamnt
atggagctggcggcctggtaccgctgggggctcctcctcgccctcttgccccccggagct
gcgggcacccaagtgtgcaccggcacagacatgaagctgcggctccctgccagtcccgag
acccacctggacatgctccgccacctctaccagggctgccaggtggtgcagggtaacctg
gaactcacctacctgcccaccaatgccagcctctccttcctgcaggatatccaggaggtg
cagggctacgtgctcatcgctcacaaccaagtgaggcaggtcccactgcagaggctgcgg
attgtgcgaggcacccagctctttgaggacaactatgccctggccgtgctagacaatgga
gacctgctgaacaataccacccctgtcacaggggcctccccaggaggcctgcgggagctg
cagcttcgaagcctcacagagatcttgaaaggaggggtcttgatccagcggaacccccag
ctctgctaccaggacacgattttgtggaaggacatcttccataagaacaaccagctggct
ctcacactgatcgacaccaaccgctctcgggcctgccacccctgttctccagtgtgtaag
ggctcccgctgctggggagagagttctgaggattgtcagagcctgacgcgcactgtctgt
gccggtggctgtgcccgctgcaaggggccactgcccactgactgctgccatgagcagtgt
gctgccggctgcacgggccccaagcactctgactgcctggcctgcctccacttcaaccac
agcggcatctgtgaactgcactgcccagccctggtcacctacaacacagacacctttgag
tccatgcccaaccccgagggccggtatacattcggcgccagctgtgtgactgcctgtccc
tacaactacctttctacggacgtgggatcctgcaccctcgtctgccccctgcacaaccaa
gaggtgacagcggaggacggaacacagcgatgtgagaagtgcagcaagccctgtgcccga
gtgtgctatggtctgggcatggagcacttgcgagaggtgagggcggtcaccagtgccaat
atccaggagtttgctggctgcaagaagatctttgggagcttggcatttctgccagagagc
tttgatggcgacccagcctccaacaccgccccgcttcagccggagcagctccgagtgttt
gagactctggaagagatcacaggttacctatacatctcagcatggccagacagcctgcct
gaccttagcgtcctccagaacctgcaagtaatccggggacgaattctgcacaatggcgcc
tactcactgaccctgcaagggctgggcatcagctggctggggctgcgctcgctgagggaa
ctgggcagtggactggccctcatccaccataacacccgcctctgctttgtgcacacggtg
ccctgggaccagctcttccggaacccgcaccaagccctgctccacactgccaaccggcca
gaggacgagtgtgtgggcgagggcctggcctgccaccagctgtgcgcccgagggcactgc
tggggtccagggcccacccagtgtgtcaactgcagccagttccttcggggccaggagtgc
gtggaggaatgccgagtactgcaggggctccccagggagtatgtgaatgccagacactgt
ttgccgtgccaccctgagtgtcagccccagaatggctcagtgacatgttttggaccggag
gctgaccagtgtgtggcctgtgcccactataaggaccctcccttctgcgtggcccgctgc
cccagcggtgtgaaacctgacctctcctacatgcccatctggaagtttccagatgaggag
ggcacgtgccagtcttgccccatcaactgcacccactcctgtgtggacctggatgacaag
ggctgccccgccgagcagagagccagccctctgacgtccatcatctctgctgtggtgggc
attctgctggtcgtggtcttgggggtggtctttggaatcctcatcaagcgacggcagcag
aagatccggaagtacacgatgcggaggctgctgcaggaaacggagctggtggagccactg
acaccgagtggagcgatgcccaaccaggcgcagatgcggatcctgaaagagacggagctg
aggaaggtgaaggtgcttggatctggagcttttggcacagtctacaagggcatctggatc
cctgatggggagaatgtgaaaattccagtggccatcaaagtgttgagggaaaacacatcc
cccaaagccaacaaagaaatcttagacgaagcatatgtgatggctggtgtgggctcccca
tatgtctcccgcctcctgggcatctgcctgacatccacggtgcagctggtgacacagctt
atgccctatggctgcctcttagaccatgtccgagaaaaccgcggacgcctgggctcccag
gacctgctgaactggtgtatgcagattgccaaggggatgagctacctggaggatgtgcgg
ctcgtacacagggacttggctgctcggaacgtgctggtcaagagtcccaaccatgtcaaa
attacagactttgggctggctcggctgctggacattgacgagacagagtaccatgcagat
gggggcaaggtgcccatcaagtggatggcgctggagtccattctccgacggcggttcacc
caccagagtgatgtgtggagttatggtgtgactgtgtgggagctgatgacttttggggcc
aaaccttacgatgggatcccagcccgggagatccctgacctgctggaaaagggggagcgg
ctgccccagccccccatctgcaccattgatgtctacatgatcatggtcaaatgttggatg
attgactctgaatgtcggccgagattccgggagttggtgtcggaattctcccgcatggcc
agggacccccagcgctttgtggtcatccagaatgaggacttgggcccagccagtcccttg
gacagcaccttctaccgctcactgctggaggacgatgacatgggggacctggtggatgct
gaggagtatctggtaccccagcagggcttcttctgtccagaccctgccccgggcactggg
ggcatggtccaccacaggcaccgcagctcatctaccaggagtggcggtggggacctgacg
ctagggctggagccctctgaagaggaggcccccaggtctccacgggcaccctccgaaggg
actggctctgatgtatttgatggtgacctaggaatgggggcagccaaggggctgcaaagc
ctccccgcacatgaccccagccctctacagcggtacagtgaggaccccacggtacccctg
ccttctgagactgacggctacgttgcccccctgacctgcagtccccagcccgaatatgtg
aaccagccagatgttcggccacagcccccttcgccccaagagggccctctgtctcctgcc
cgacctactggtgccactctggaaaggcccaagactctctccccagggaagaatggggtt
gtcaaagacgtttttgcctttgggggtgctgtggagaaccccgagtacttggcaccccgg
ggaggagctgcccctcagccccaccttcctcctgccttcagcccagccttcgacaacctc
tattactgggaccaggacccatcagagcggggggctccacctagcaccttcaaagggaca
cctacggcagagaacccagagtacctgggtctggacgtgccagtgtga

DBGET integrated database retrieval system