KEGG   Macaca mulatta (rhesus monkey): 697661
Entry
697661            CDS       T01028                                 

Gene name
CAMK1D
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type 1D isoform X3
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04020  Calcium signaling pathway
mcc04921  Oxytocin signaling pathway
mcc04925  Aldosterone synthesis and secretion
mcc05214  Glioma
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    697661 (CAMK1D)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    697661 (CAMK1D)
   04925 Aldosterone synthesis and secretion
    697661 (CAMK1D)
 09160 Human Diseases
  09162 Cancer: specific types
   05214 Glioma
    697661 (CAMK1D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    697661 (CAMK1D)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     697661 (CAMK1D)
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   697661 (CAMK1D)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo Pkinase_fungal RIO1 APH 5_nucleotid Pox_ser-thr_kin
Other DBs
NCBI-GeneID: 697661
NCBI-ProteinID: XP_015001968
Ensembl: ENSMMUG00000011956
LinkDB
Position
9
AA seq 362 aa
MARENGESSSSWKKQAEDIKKIFEFKETLGTGAFSEVVLAEEKATGKLFAVKCIPKKALK
GKESSIENEIAVLRKIKHENIVALEDIYESPNHLYLVMQLVSGGELFDRIVEKGFYTEKD
ASTLIRQVLDAVYYLHRMGIVHRDLKPENLLYYSQDEESKIMISDFGLSKMEGKGDVMST
ACGTPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDSKLFEQILKAEYEF
DSPYWDDISDSAKDFIRNLMEKDPNKRYTCEQAARHPWIAGDTALNKNIHESVSAQIRKN
FAKSKWRQAFNATAVVRHMRKLHLGSSLDSSNVWHLPRSVVSFLLHRGSQELEPSGDPGP
PL
NT seq 1089 nt   +upstreamnt  +downstreamnt
atggcccgggagaacggcgagagcagctcctcctggaaaaagcaagctgaagatatcaag
aagatcttcgagttcaaggagaccctcggaaccggggccttttcggaagtggttttagct
gaagagaaggcaactggcaagctctttgccgtgaagtgtatccctaagaaggcgctgaag
ggcaaggaaagcagcatagagaatgagatagctgtcctgagaaagattaagcatgaaaat
attgttgccctggaagacatttatgaaagcccaaatcacttgtacttggtcatgcagctg
gtgtctggtggcgagctgtttgaccggatagtggagaaggggttttatacggagaaggat
gccagcactctgatccgccaagtcttggacgccgtgtactatctccacagaatgggcatc
gtccacagggacctcaagcctgaaaatctcttatactacagtcaagatgaggagtccaaa
atcatgatcagtgactttggattgtcaaaaatggagggcaaaggagacgtgatgtccact
gcctgtggaactccaggctatgttgctcctgaagtccttgcccagaagccttacagcaaa
gctgttgactgctggtccatcggggtgattgcctatatcttgctctgcggctaccctcct
ttttatgatgaaaatgactccaagctctttgagcagatcctcaaggcagaatatgagttt
gactctccctactgggatgacatctctgactctgcaaaagacttcattcggaacctgatg
gagaaggacccaaataaaagatacacgtgtgagcaggcagctcggcacccatggatcgct
ggtgacacagccctcaacaaaaacatccacgagtccgtcagcgcccagatccggaagaac
ttcgccaagagcaaatggagacaagcgttcaacgccacggccgtcgtgagacatatgaga
aagctacacctcggcagcagcctggacagttccaatgtctggcaccttccacgctctgta
gtttcatttcttcttcatcgggggtctcaggagttggagccgagcggagacccaggccca
ccactgtga

KEGG   Macaca mulatta (rhesus monkey): 700212
Entry
700212            CDS       T01028                                 

Gene name
CAMK1
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type 1
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04020  Calcium signaling pathway
mcc04921  Oxytocin signaling pathway
mcc04925  Aldosterone synthesis and secretion
mcc05214  Glioma
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    700212 (CAMK1)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    700212 (CAMK1)
   04925 Aldosterone synthesis and secretion
    700212 (CAMK1)
 09160 Human Diseases
  09162 Cancer: specific types
   05214 Glioma
    700212 (CAMK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    700212 (CAMK1)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     700212 (CAMK1)
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   700212 (CAMK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo Pkinase_fungal APH RIO1 Tyrosinase
Other DBs
NCBI-GeneID: 700212
NCBI-ProteinID: NP_001244800
Ensembl: ENSMMUG00000006120
UniProt: I0FVW2 G7MKS2
LinkDB
Position
2
AA seq 370 aa
MPGAVEGPRWKQAEDIRDIYDFRDVLGTGAFSEVILAEDKRTQKLVAIKCIAKKALEGKE
GSMENEIAVLHKIKHPNIVALDDIYESGGHLYLIMQLVSGGELFDRIVEKGFYTERDASR
LIFQVLDAVKYLHDLGIVHRDLKPENLLYYSLDEDSKIMISDFGLSKMEDPGSVLSTACG
TPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDAKLFEQILKAEYEFDSP
YWDDISDSAKDFIRHLMEKDPEKRFTCEQALQHPWIAGDTALDKNIHQSVSEQIKKNFAK
SKWKQAFNATAVVRHMRKLQLGTSQEGQGQTASHGELLTPVAGGPATGCCCRDCCVEPGP
ELSPTLPHQL
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgccgggggcagtggaaggccccaggtggaagcaggcagaggacattagggacatttac
gacttccgagatgttctgggcacgggggccttctcggaggtgatcctggcagaagataaa
aggacgcagaagctggtggccatcaaatgcattgccaagaaggccctggagggcaaggaa
ggcagcatggagaatgagattgctgtcctgcacaagatcaagcaccccaacattgtagcc
ctggatgacatctatgagagtgggggccatctctacctcatcatgcagctggtgtcgggt
ggggagctctttgaccgtattgtggaaaaaggcttctacacggagcgggacgccagccgc
ctcatcttccaggtgctggatgctgtgaaatacctacatgacctgggcattgtacaccgg
gatctcaagccagagaatctgctatactacagcctggatgaagactccaaaataatgatc
tccgactttggcctctccaagatggaggacccgggcagtgtgctctccaccgcctgcgga
actccgggatacgtggcccctgaggtcctggcccaaaagccctacagcaaggctgtggat
tgctggtccataggtgtcatcgcctacatcctgctctgcggttatccccccttctatgat
gagaatgatgccaaactctttgaacagattttgaaggccgagtacgagtttgactctcct
tactgggacgacatctctgactccgccaaagatttcatccggcacttgatggagaaggac
ccagagaaaagattcacctgtgagcaggccttgcagcacccatggattgcaggagatacg
gctctagataagaatatccaccagtcggtgagtgagcagatcaagaagaactttgccaag
agcaagtggaagcaagccttcaatgccacggctgtggtgcggcacatgaggaaactgcag
ctaggcaccagccaggaggggcaggggcagacggcgagccacggggagctgctgacacca
gtggctggggggccggcaactggctgttgctgtcgagactgctgcgtggagccgggccca
gaactgtcccccacactgccccaccagctctag

KEGG   Macaca mulatta (rhesus monkey): 702504
Entry
702504            CDS       T01028                                 

Gene name
CAMK2D
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit delta isoform X2
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04012  ErbB signaling pathway
mcc04020  Calcium signaling pathway
mcc04024  cAMP signaling pathway
mcc04066  HIF-1 signaling pathway
mcc04114  Oocyte meiosis
mcc04217  Necroptosis
mcc04261  Adrenergic signaling in cardiomyocytes
mcc04310  Wnt signaling pathway
mcc04360  Axon guidance
mcc04713  Circadian entrainment
mcc04720  Long-term potentiation
mcc04722  Neurotrophin signaling pathway
mcc04725  Cholinergic synapse
mcc04728  Dopaminergic synapse
mcc04740  Olfactory transduction
mcc04750  Inflammatory mediator regulation of TRP channels
mcc04911  Insulin secretion
mcc04912  GnRH signaling pathway
mcc04916  Melanogenesis
mcc04921  Oxytocin signaling pathway
mcc04922  Glucagon signaling pathway
mcc04925  Aldosterone synthesis and secretion
mcc04934  Cushing syndrome
mcc04971  Gastric acid secretion
mcc05012  Parkinson disease
mcc05022  Pathways of neurodegeneration - multiple diseases
mcc05031  Amphetamine addiction
mcc05152  Tuberculosis
mcc05200  Pathways in cancer
mcc05205  Proteoglycans in cancer
mcc05214  Glioma
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    702504 (CAMK2D)
   04310 Wnt signaling pathway
    702504 (CAMK2D)
   04066 HIF-1 signaling pathway
    702504 (CAMK2D)
   04020 Calcium signaling pathway
    702504 (CAMK2D)
   04024 cAMP signaling pathway
    702504 (CAMK2D)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    702504 (CAMK2D)
   04217 Necroptosis
    702504 (CAMK2D)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    702504 (CAMK2D)
   04922 Glucagon signaling pathway
    702504 (CAMK2D)
   04912 GnRH signaling pathway
    702504 (CAMK2D)
   04921 Oxytocin signaling pathway
    702504 (CAMK2D)
   04916 Melanogenesis
    702504 (CAMK2D)
   04925 Aldosterone synthesis and secretion
    702504 (CAMK2D)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    702504 (CAMK2D)
  09154 Digestive system
   04971 Gastric acid secretion
    702504 (CAMK2D)
  09156 Nervous system
   04725 Cholinergic synapse
    702504 (CAMK2D)
   04728 Dopaminergic synapse
    702504 (CAMK2D)
   04720 Long-term potentiation
    702504 (CAMK2D)
   04722 Neurotrophin signaling pathway
    702504 (CAMK2D)
  09157 Sensory system
   04740 Olfactory transduction
    702504 (CAMK2D)
   04750 Inflammatory mediator regulation of TRP channels
    702504 (CAMK2D)
  09158 Development and regeneration
   04360 Axon guidance
    702504 (CAMK2D)
  09159 Environmental adaptation
   04713 Circadian entrainment
    702504 (CAMK2D)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    702504 (CAMK2D)
   05205 Proteoglycans in cancer
    702504 (CAMK2D)
  09162 Cancer: specific types
   05214 Glioma
    702504 (CAMK2D)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    702504 (CAMK2D)
   05022 Pathways of neurodegeneration - multiple diseases
    702504 (CAMK2D)
  09165 Substance dependence
   05031 Amphetamine addiction
    702504 (CAMK2D)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    702504 (CAMK2D)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    702504 (CAMK2D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    702504 (CAMK2D)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     702504 (CAMK2D)
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   702504 (CAMK2D)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr SnoaL_3 DUF4440 APH Kdo Pkinase_fungal SnoaL_2 SnoaL_4
Other DBs
NCBI-GeneID: 702504
NCBI-ProteinID: XP_001096573
Ensembl: ENSMMUG00000008587
UniProt: F7H4F4
LinkDB
Position
5
AA seq 533 aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLER
EARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQI
LEAVLHCHQMGVVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDT
VTPEAKDLINKMLTINPAKRITASEALKHPWICQRSTVASMMHRQETVDCLKKFNARRKL
KGAILTTMLATRNFSAAKSLLKKPDGVKINNKANVVTSPKENIPTPALEPQTTVIHNPDG
NKESTESSNTTIEDEDVKARKQEIIKVTEQLIEAINNGDFEAYTKICDPGLTAFEPEALG
NLVEGMDFHRFYFENALSKSNKPIHTIILNPHVHLVGDDAACIAYIRLTQYMDGSGMPKT
MQSEETRVWHRRDGKWQNVHFHRSGSPTVPIKPPCIPNGKENFSGGTSLWQNI
NT seq 1602 nt   +upstreamnt  +downstreamnt
atggcttcgaccacaacctgcaccaggttcacggacgagtatcagcttttcgaggagctt
ggaaagggggcattctcagtggtgagaagatgtatgaaaattcctactggacaagaatat
gctgccaaaattatcaacaccaaaaagctttctgctagggatcatcagaaactagaaaga
gaagctagaatctgccgtcttttgaagcaccctaatattgtgcgacttcatgatagcata
tcagaggagggctttcactacttggtgtttgatttagttaccggaggtgaactgtttgaa
gacatagtggcaagagaatactacagtgaagctgatgccagtcattgcattcagcagatc
ctggaggctgtgctacactgccatcagatgggcgtggtccatcgggacctgaagcctgag
aatttgcttttagctagcaaatccaagggagcagctgtgaaattggcagactttggctta
gccatagaagttcaaggggaccagcaggcgtggtttggttttgctggcacacctggatat
ctttctccagaagttttacgtaaagatccttatggaaagccagtggatatgtgggcatgt
ggtgtcattctctatattctacttgtggggtatccacccttctgggatgaagaccaacac
agactctatcagcagatcaaggctggagcttatgattttccatcaccggaatgggacacg
gtaactcctgaagccaaagacctcatcaataaaatgcttactatcaaccctgccaaacgt
atcacagcctcagaggcactgaagcacccatggatctgtcaacgttctactgttgcttcc
atgatgcacagacaggagactgtagactgcttgaagaaatttaatgctagaagaaaacta
aagggtgccatcttgacaactatgctggctacaagaaatttctcagcagccaagagtttg
ttgaagaaaccagatggagtaaagataaacaacaaagccaacgtggtaaccagccccaaa
gaaaatattcctaccccggcgctggagccccaaactactgtaatccacaaccctgatgga
aacaaggagtcaactgagagttcaaatacaacaattgaggatgaagatgtgaaagcacga
aagcaagagattatcaaagtcaccgaacaactgattgaagctatcaacaacggggacttt
gaagcctacacaaaaatctgtgacccaggccttactgcttttgaacctgaagctctgggt
aatttagtggaagggatggattttcaccgattctacttcgaaaatgctttgtccaaaagc
aataaaccaatccacactattattctaaaccctcatgtacatctggtaggggatgatgcc
gcctgcatagcgtatattaggctcacacagtacatggatggcagtggaatgccaaagaca
atgcagtcagaagagactcgtgtgtggcaccgtcgagatggaaagtggcagaatgttcat
tttcatcgctcggggtcaccaacagtacccatcaagccaccctgtattccaaatgggaaa
gaaaacttctcaggaggcacctctttgtggcaaaacatctaa

KEGG   Macaca mulatta (rhesus monkey): 705980
Entry
705980            CDS       T01028                                 

Gene name
CAMK2G
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit gamma
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04012  ErbB signaling pathway
mcc04020  Calcium signaling pathway
mcc04024  cAMP signaling pathway
mcc04066  HIF-1 signaling pathway
mcc04114  Oocyte meiosis
mcc04217  Necroptosis
mcc04261  Adrenergic signaling in cardiomyocytes
mcc04310  Wnt signaling pathway
mcc04360  Axon guidance
mcc04713  Circadian entrainment
mcc04720  Long-term potentiation
mcc04722  Neurotrophin signaling pathway
mcc04725  Cholinergic synapse
mcc04728  Dopaminergic synapse
mcc04740  Olfactory transduction
mcc04750  Inflammatory mediator regulation of TRP channels
mcc04911  Insulin secretion
mcc04912  GnRH signaling pathway
mcc04916  Melanogenesis
mcc04921  Oxytocin signaling pathway
mcc04922  Glucagon signaling pathway
mcc04925  Aldosterone synthesis and secretion
mcc04934  Cushing syndrome
mcc04971  Gastric acid secretion
mcc05012  Parkinson disease
mcc05022  Pathways of neurodegeneration - multiple diseases
mcc05031  Amphetamine addiction
mcc05152  Tuberculosis
mcc05200  Pathways in cancer
mcc05205  Proteoglycans in cancer
mcc05214  Glioma
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    705980 (CAMK2G)
   04310 Wnt signaling pathway
    705980 (CAMK2G)
   04066 HIF-1 signaling pathway
    705980 (CAMK2G)
   04020 Calcium signaling pathway
    705980 (CAMK2G)
   04024 cAMP signaling pathway
    705980 (CAMK2G)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    705980 (CAMK2G)
   04217 Necroptosis
    705980 (CAMK2G)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    705980 (CAMK2G)
   04922 Glucagon signaling pathway
    705980 (CAMK2G)
   04912 GnRH signaling pathway
    705980 (CAMK2G)
   04921 Oxytocin signaling pathway
    705980 (CAMK2G)
   04916 Melanogenesis
    705980 (CAMK2G)
   04925 Aldosterone synthesis and secretion
    705980 (CAMK2G)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    705980 (CAMK2G)
  09154 Digestive system
   04971 Gastric acid secretion
    705980 (CAMK2G)
  09156 Nervous system
   04725 Cholinergic synapse
    705980 (CAMK2G)
   04728 Dopaminergic synapse
    705980 (CAMK2G)
   04720 Long-term potentiation
    705980 (CAMK2G)
   04722 Neurotrophin signaling pathway
    705980 (CAMK2G)
  09157 Sensory system
   04740 Olfactory transduction
    705980 (CAMK2G)
   04750 Inflammatory mediator regulation of TRP channels
    705980 (CAMK2G)
  09158 Development and regeneration
   04360 Axon guidance
    705980 (CAMK2G)
  09159 Environmental adaptation
   04713 Circadian entrainment
    705980 (CAMK2G)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    705980 (CAMK2G)
   05205 Proteoglycans in cancer
    705980 (CAMK2G)
  09162 Cancer: specific types
   05214 Glioma
    705980 (CAMK2G)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    705980 (CAMK2G)
   05022 Pathways of neurodegeneration - multiple diseases
    705980 (CAMK2G)
  09165 Substance dependence
   05031 Amphetamine addiction
    705980 (CAMK2G)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    705980 (CAMK2G)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    705980 (CAMK2G)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    705980 (CAMK2G)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     705980 (CAMK2G)
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   705980 (CAMK2G)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr SnoaL_3 DUF4440 APH Pkinase_fungal Kdo SnoaL_2 RIO1
Other DBs
NCBI-GeneID: 705980
NCBI-ProteinID: NP_001253098
Ensembl: ENSMMUG00000021393
UniProt: H9G0A4
LinkDB
Position
9
AA seq 556 aa
MATTATCTRFTDDYQLFEELGKGAFSVVRRCVKKTSTQEYAAKIINTKKLSARDHQKLER
EARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIHQI
LESVNHIHQHDIVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGEQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDT
VTPEAKNLINQMLTINPAKRITADQALKHPWVCQRSTVASMMHRQETVECLRKFNARRKL
KGAILTTMLVSRNFSAAKSLLNKKSDGGVKPQSNNKNSLVSPAQEPAPLQTAMEPQTTVV
HNATDGIKGSTESCNTTTEDEDLKAAPLRTGNGSLVPEGRSSRDRTAPSAGMQPQPSLCS
SAMRKQEIIKITEQLIEAINNGDFEAYTKICDPGLTSFEPEALGNLVEGMDFHKFYFENL
LSKNSKPIHTTILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKW
LNVHYHCSGASAAPLQ
NT seq 1671 nt   +upstreamnt  +downstreamnt
atggccaccaccgccacctgcacccgcttcaccgacgactaccagctcttcgaggagctt
ggcaagggtgctttctctgtggtccgcaggtgtgtgaagaaaacctccacgcaggagtat
gcagcaaaaatcatcaataccaagaagttgtctgcccgggatcaccagaaactagaacgt
gaggctcgaatatgtcgacttctgaaacatccaaacatcgtgcgcctccatgacagtatt
tctgaagaagggtttcactacctcgtgtttgaccttgttaccggcggggagctgtttgaa
gacattgtggccagagagtactacagtgaagcagatgccagccactgtatacatcagatt
ctggagagtgttaaccacatccaccagcatgacatcgtccacagggacctgaagcctgag
aacctgctgctggcgagtaaatgcaagggtgccgctgtcaagctggctgattttggccta
gccatcgaagtacagggagagcagcaggcttggtttggttttgctggaaccccaggttac
ttgtcccctgaggtcttgaggaaagatccctatggaaaacctgtggatatctgggcctgc
ggggtcatcctgtatatcctcctggtgggctatcctcccttctgggatgaggatcagcac
aagctgtatcagcagatcaaggctggagcctatgatttcccatcaccagaatgggacacg
gtaactcctgaagccaagaacttgatcaaccagatgctgaccataaacccagcaaagcgc
atcacggctgaccaggctctcaagcacccgtgggtctgtcaacgatccacggtggcatcc
atgatgcatcgtcaggagactgtggagtgtttgcgcaagttcaacgcccggagaaaactg
aagggtgccatcctcacaaccatgcttgtctccaggaacttctcagctgccaaaagccta
ttgaacaagaagtcggatggcggtgtcaagccacagagcaacaacaaaaacagtctcgta
agcccagcccaagagcccgcgcccttgcagacggccatggagccacaaaccactgtggta
cacaacgctacagatgggatcaagggctccacagagagctgcaacaccaccacagaagat
gaggacctcaaagctgccccgctccgcactgggaatggcagcttggtgcctgaaggacgg
agctcccgggacagaacagccccctctgcaggcatgcagccccagccttctctctgctcc
tcagccatgagaaaacaggagatcattaagattacagaacagctgattgaagccatcaac
aatggggactttgaggcctacacgaagatttgtgatccaggcctcacttcctttgagcct
gaggcccttggtaacctcgtggaggggatggatttccataagttttactttgagaatctc
ctgtccaagaacagcaagcctatccataccaccatcctaaacccacacgtccacgtgatt
ggggaggacgcagcgtgcatcgcctacatccgcctcacccagtacatcgacgggcagggt
cggcctcgcaccagccagtcagaagagacccgggtctggcaccgtcgggatggcaagtgg
ctcaatgtccactatcactgctcaggggcctctgccgcaccgctgcagtga

KEGG   Macaca mulatta (rhesus monkey): 706977
Entry
706977            CDS       T01028                                 

Gene name
CAMK2B
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit beta isoform X11
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04012  ErbB signaling pathway
mcc04020  Calcium signaling pathway
mcc04024  cAMP signaling pathway
mcc04066  HIF-1 signaling pathway
mcc04114  Oocyte meiosis
mcc04217  Necroptosis
mcc04261  Adrenergic signaling in cardiomyocytes
mcc04310  Wnt signaling pathway
mcc04360  Axon guidance
mcc04713  Circadian entrainment
mcc04720  Long-term potentiation
mcc04722  Neurotrophin signaling pathway
mcc04725  Cholinergic synapse
mcc04728  Dopaminergic synapse
mcc04740  Olfactory transduction
mcc04750  Inflammatory mediator regulation of TRP channels
mcc04911  Insulin secretion
mcc04912  GnRH signaling pathway
mcc04916  Melanogenesis
mcc04921  Oxytocin signaling pathway
mcc04922  Glucagon signaling pathway
mcc04925  Aldosterone synthesis and secretion
mcc04934  Cushing syndrome
mcc04971  Gastric acid secretion
mcc05012  Parkinson disease
mcc05022  Pathways of neurodegeneration - multiple diseases
mcc05031  Amphetamine addiction
mcc05152  Tuberculosis
mcc05200  Pathways in cancer
mcc05205  Proteoglycans in cancer
mcc05214  Glioma
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    706977 (CAMK2B)
   04310 Wnt signaling pathway
    706977 (CAMK2B)
   04066 HIF-1 signaling pathway
    706977 (CAMK2B)
   04020 Calcium signaling pathway
    706977 (CAMK2B)
   04024 cAMP signaling pathway
    706977 (CAMK2B)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    706977 (CAMK2B)
   04217 Necroptosis
    706977 (CAMK2B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    706977 (CAMK2B)
   04922 Glucagon signaling pathway
    706977 (CAMK2B)
   04912 GnRH signaling pathway
    706977 (CAMK2B)
   04921 Oxytocin signaling pathway
    706977 (CAMK2B)
   04916 Melanogenesis
    706977 (CAMK2B)
   04925 Aldosterone synthesis and secretion
    706977 (CAMK2B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    706977 (CAMK2B)
  09154 Digestive system
   04971 Gastric acid secretion
    706977 (CAMK2B)
  09156 Nervous system
   04725 Cholinergic synapse
    706977 (CAMK2B)
   04728 Dopaminergic synapse
    706977 (CAMK2B)
   04720 Long-term potentiation
    706977 (CAMK2B)
   04722 Neurotrophin signaling pathway
    706977 (CAMK2B)
  09157 Sensory system
   04740 Olfactory transduction
    706977 (CAMK2B)
   04750 Inflammatory mediator regulation of TRP channels
    706977 (CAMK2B)
  09158 Development and regeneration
   04360 Axon guidance
    706977 (CAMK2B)
  09159 Environmental adaptation
   04713 Circadian entrainment
    706977 (CAMK2B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    706977 (CAMK2B)
   05205 Proteoglycans in cancer
    706977 (CAMK2B)
  09162 Cancer: specific types
   05214 Glioma
    706977 (CAMK2B)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    706977 (CAMK2B)
   05022 Pathways of neurodegeneration - multiple diseases
    706977 (CAMK2B)
  09165 Substance dependence
   05031 Amphetamine addiction
    706977 (CAMK2B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    706977 (CAMK2B)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    706977 (CAMK2B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    706977 (CAMK2B)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     706977 (CAMK2B)
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   706977 (CAMK2B)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr DUF4440 SnoaL_3 SnoaL_2 APH Kdo Pkinase_fungal SnoaL_4
Other DBs
NCBI-GeneID: 706977
NCBI-ProteinID: XP_014989106
Ensembl: ENSMMUG00000002433
LinkDB
Position
3
AA seq 668 aa
MATTVTCTRFTDEYQLYEDIGKGAFSVVRRCVKLCTGHEYAAKIINTKKLSARDHQKLER
EARICRLLKHSNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQI
LEAVLHCHQMGVVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKEAYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDT
VTPEAKNLINQMLTINPAKRITAHEALKHPWVCQRSTVASMMHRQETVECLKKFNARRKL
KGAILTTMLATRNFSVGRQTTAPATMSTAASGTTMGLVEQAKSLLNKKADGVKPQTNSTK
NSAAATSPKGTLPPAALEPQTTVIHNPVDGIKESSDSANTTIEDEDAKAPRVPDILSSVR
RGSGAPEAEGPLPCPSPAPAPFSPLPAPTPRISDILNSVRRGSGTPEAEGPLSAGPLPCL
SPALLGPLPSPSPRISDILNSVRRGSGTPEAEGPSPVGPLPCPSPTIPGPLPTPSRKQEI
IKTTEQLIEAVNNGDFEAYAKICDPGLTSFEPEALGNLVEGMDFHRFYFENLLAKNSKPI
HTTILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWQNVHFHCS
GAPVAPLQ
NT seq 2007 nt   +upstreamnt  +downstreamnt
atggccaccacggtgacctgcacccgcttcaccgacgagtaccagctctacgaggatatt
ggcaagggggctttctctgtggtccgacgctgtgtcaagctctgcaccggccatgagtat
gcagccaagatcatcaacaccaagaagctgtcagccagagatcaccagaagttggagaga
gaggctcggatctgccgccttctgaagcattccaatatcgtgcgtctccacgacagcatc
tccgaggagggcttccactacctggtcttcgatctggtcactggtggggagctctttgaa
gacattgtggcgagagaatactacagcgaggctgatgccagtcactgcatccagcagatc
ctggaggccgttctccattgtcaccaaatgggggtcgtccacagagacctcaagccggag
aacctgctcctggccagcaagtgcaaaggggctgcagtgaagctggcagacttcggcctg
gctatcgaggtgcagggggaccagcaggcgtggtttgggttcgctggcacaccaggctac
ctgtcccctgaggtccttcgcaaagaggcgtatggcaagcccgtggacatctgggcatgt
ggggtgatcctgtacatcctgctcgtgggctacccacccttctgggacgaggaccagcac
aagctgtaccagcagatcaaggccggcgcctacgacttcccgtcccccgaatgggacact
gtcactcctgaagccaaaaacctaatcaaccagatgctgaccatcaaccctgccaagcgc
atcacagcccatgaggccctgaagcatccgtgggtctgccaacgttccacggtagcctcc
atgatgcacagacaggagactgtggagtgtctgaaaaagttcaatgccaggagaaagctc
aagggagccatcctcaccaccatgctggccacacggaatttctcagtgggcagacagacc
accgctccggccacaatgtccaccgcggcctccggcaccaccatggggctggtggaacaa
gccaagagtttactcaacaagaaagcagatggagtcaagccccagacgaatagcaccaaa
aacagtgcagccgccaccagccccaaagggacgcttcctcctgccgccctggagcctcaa
accaccgtcatccataacccagtggacgggattaaggagtcttctgacagtgccaacacc
accatagaggatgaagacgctaaagcccccagggtccctgacatcctgagctcagtgagg
aggggctcgggagccccagaagccgaggggcccctgccctgcccatctccagctccagct
ccctttagccccctgccagccccaacccccaggatctctgacatcctgaactctgtgaga
aggggctcaggaaccccagaagccgagggccccctctcagcggggcccctgccctgcctg
tctccggctctcctaggccccctaccctccccatccccgaggatctctgacatcctgaac
tctgtgaggaggggctcagggaccccagaagctgagggcccctcaccagtggggcccctg
ccctgcccatctccgactatccctggccccctgcccaccccgtcccggaagcaggagatc
attaagaccacggagcagctcatcgaggctgtcaacaacggtgactttgaggcctacgcg
aaaatctgtgacccagggctgacctcatttgagcctgaagcactgggcaacctggttgaa
gggatggacttccacagattctacttcgagaacctgctggccaagaacagcaagccgatc
cacacgaccatcctgaacccgcacgtgcacgtcatcggagaggacgccgcctgcattgct
tacatccggctcacgcagtacattgacgggcagggccggccccgcaccagccagtctgag
gagacccgtgtgtggcaccgccgcgacggcaagtggcagaacgtgcacttccactgctcg
ggcgcgcctgtggccccgctgcagtga

KEGG   Macaca mulatta (rhesus monkey): 710540
Entry
710540            CDS       T01028                                 

Gene name
CAMK2A
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit alpha isoform X1
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04012  ErbB signaling pathway
mcc04020  Calcium signaling pathway
mcc04024  cAMP signaling pathway
mcc04066  HIF-1 signaling pathway
mcc04114  Oocyte meiosis
mcc04217  Necroptosis
mcc04261  Adrenergic signaling in cardiomyocytes
mcc04310  Wnt signaling pathway
mcc04360  Axon guidance
mcc04713  Circadian entrainment
mcc04720  Long-term potentiation
mcc04722  Neurotrophin signaling pathway
mcc04725  Cholinergic synapse
mcc04728  Dopaminergic synapse
mcc04740  Olfactory transduction
mcc04750  Inflammatory mediator regulation of TRP channels
mcc04911  Insulin secretion
mcc04912  GnRH signaling pathway
mcc04916  Melanogenesis
mcc04921  Oxytocin signaling pathway
mcc04922  Glucagon signaling pathway
mcc04925  Aldosterone synthesis and secretion
mcc04934  Cushing syndrome
mcc04971  Gastric acid secretion
mcc05012  Parkinson disease
mcc05022  Pathways of neurodegeneration - multiple diseases
mcc05031  Amphetamine addiction
mcc05152  Tuberculosis
mcc05200  Pathways in cancer
mcc05205  Proteoglycans in cancer
mcc05214  Glioma
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    710540 (CAMK2A)
   04310 Wnt signaling pathway
    710540 (CAMK2A)
   04066 HIF-1 signaling pathway
    710540 (CAMK2A)
   04020 Calcium signaling pathway
    710540 (CAMK2A)
   04024 cAMP signaling pathway
    710540 (CAMK2A)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    710540 (CAMK2A)
   04217 Necroptosis
    710540 (CAMK2A)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    710540 (CAMK2A)
   04922 Glucagon signaling pathway
    710540 (CAMK2A)
   04912 GnRH signaling pathway
    710540 (CAMK2A)
   04921 Oxytocin signaling pathway
    710540 (CAMK2A)
   04916 Melanogenesis
    710540 (CAMK2A)
   04925 Aldosterone synthesis and secretion
    710540 (CAMK2A)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    710540 (CAMK2A)
  09154 Digestive system
   04971 Gastric acid secretion
    710540 (CAMK2A)
  09156 Nervous system
   04725 Cholinergic synapse
    710540 (CAMK2A)
   04728 Dopaminergic synapse
    710540 (CAMK2A)
   04720 Long-term potentiation
    710540 (CAMK2A)
   04722 Neurotrophin signaling pathway
    710540 (CAMK2A)
  09157 Sensory system
   04740 Olfactory transduction
    710540 (CAMK2A)
   04750 Inflammatory mediator regulation of TRP channels
    710540 (CAMK2A)
  09158 Development and regeneration
   04360 Axon guidance
    710540 (CAMK2A)
  09159 Environmental adaptation
   04713 Circadian entrainment
    710540 (CAMK2A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    710540 (CAMK2A)
   05205 Proteoglycans in cancer
    710540 (CAMK2A)
  09162 Cancer: specific types
   05214 Glioma
    710540 (CAMK2A)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    710540 (CAMK2A)
   05022 Pathways of neurodegeneration - multiple diseases
    710540 (CAMK2A)
  09165 Substance dependence
   05031 Amphetamine addiction
    710540 (CAMK2A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    710540 (CAMK2A)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    710540 (CAMK2A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    710540 (CAMK2A)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     710540 (CAMK2A)
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   710540 (CAMK2A)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr SnoaL_3 DUF4440 APH Kdo SnoaL_2 SnoaL_4
Other DBs
NCBI-GeneID: 710540
NCBI-ProteinID: XP_014996717
Ensembl: ENSMMUG00000011563
UniProt: H9EMI1
LinkDB
Position
6
AA seq 489 aa
MATITCTRFTEEYQLFEELGKGAFSVVRRCVKVLAGQEYAAKIINTKKLSARDHQKLERE
ARICRLLKHPNIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQIL
EAVLHCHQMGVVHRDLKPENLLLASKLKGAAVKLADFGLAIEVEGEQQAWFGFAGTPGYL
SPEVLRKDPYGKPVDLWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTV
TPEAKDLINKMLTINPSKRITAAEALKHPWISHRSTVASCMHRQETVDCLKKFNARRKLK
GAILTTMLATRNFSGGKSGGNKKSDGVKKRKSSSSVQLMESSESTNTTIEDEDTKVRKQE
IIKVTEQLIEAISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWSRNSKP
VHTTILNPHIHLMGDESACIAYIRITQYLDAGGIPRTAQSEETRVWHRRDGKWQIVHFHR
SGAPSVLPH
NT seq 1470 nt   +upstreamnt  +downstreamnt
atggccaccatcacctgcacccgcttcacggaagagtaccagctcttcgaggaattgggc
aagggagccttctcggtggtgcgaaggtgtgtgaaggtgctggccggccaggagtatgct
gccaagatcatcaacaccaagaagctgtcagccagagaccatcagaagctggagcgtgaa
gcccgcatctgccgcctgctgaagcaccccaacattgtccgactccatgacagcatctca
gaggagggacaccactacctgatcttcgacctggtcactggtggggaactgtttgaagat
atcgtggcccgggagtattacagtgaggcggatgccagtcactgtatccagcagatcctg
gaggctgtgctgcactgccaccagatgggggtggtgcaccgggacctgaagcctgagaat
ctgttgctggcctccaagctcaagggtgccgcagtgaagctggcagactttggcctggcc
atagaggtggagggggagcagcaggcatggtttgggtttgcagggactcctggatacctc
tccccagaagtgctgcggaaggacccatacgggaagcctgtggacctgtgggcttgtggg
gtcatcctgtacatcctgctggttgggtaccccccattctgggatgaggaccagcaccgc
ctgtaccagcagatcaaagccggcgcctatgatttcccatcaccagaatgggacaccgtc
accccggaagccaaggatctgatcaataagatgctgaccattaacccatccaaacgcatc
acagctgctgaagcccttaagcacccctggatctcgcaccgctccaccgtggcatcctgc
atgcacagacaggagaccgtggactgcctgaagaagttcaatgccaggaggaaactgaag
ggagccattctcaccacgatgctggccaccaggaacttctccggagggaagagtggggga
aacaagaagagcgatggtgtgaagaaaagaaagtccagttccagcgttcagttaatggaa
tcctcagagagcaccaacaccaccatcgaggatgaagacaccaaagtgcggaaacaggaa
attataaaagtgacagagcagctgattgaagccataagcaatggagattttgagtcctac
acgaagatgtgcgaccctggcatgacagccttcgaacctgaggccctggggaacctggtt
gagggcctggacttccatcgattctattttgaaaacctgtggtcccggaacagcaagccc
gtgcacaccaccatcctgaatccccacatccacctgatgggcgacgagtcagcctgcatc
gcctacatccgcatcacgcagtacctggacgccggcggcatcccacgcaccgcccagtcg
gaggagacccgtgtctggcaccgccgggacggcaaatggcagatcgtccacttccacaga
tctggggcgccctccgtcctgccccactga

KEGG   Macaca mulatta (rhesus monkey): 712322
Entry
712322            CDS       T01028                                 

Gene name
CAMK4
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type IV isoform X1
  KO
K05869  calcium/calmodulin-dependent protein kinase IV [EC:2.7.11.17]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04020  Calcium signaling pathway
mcc04024  cAMP signaling pathway
mcc04211  Longevity regulating pathway
mcc04371  Apelin signaling pathway
mcc04380  Osteoclast differentiation
mcc04720  Long-term potentiation
mcc04722  Neurotrophin signaling pathway
mcc04725  Cholinergic synapse
mcc04921  Oxytocin signaling pathway
mcc04925  Aldosterone synthesis and secretion
mcc05031  Amphetamine addiction
mcc05034  Alcoholism
mcc05214  Glioma
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    712322 (CAMK4)
   04020 Calcium signaling pathway
    712322 (CAMK4)
   04024 cAMP signaling pathway
    712322 (CAMK4)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    712322 (CAMK4)
   04925 Aldosterone synthesis and secretion
    712322 (CAMK4)
  09156 Nervous system
   04725 Cholinergic synapse
    712322 (CAMK4)
   04720 Long-term potentiation
    712322 (CAMK4)
   04722 Neurotrophin signaling pathway
    712322 (CAMK4)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    712322 (CAMK4)
  09149 Aging
   04211 Longevity regulating pathway
    712322 (CAMK4)
 09160 Human Diseases
  09162 Cancer: specific types
   05214 Glioma
    712322 (CAMK4)
  09165 Substance dependence
   05031 Amphetamine addiction
    712322 (CAMK4)
   05034 Alcoholism
    712322 (CAMK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    712322 (CAMK4)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     712322 (CAMK4)
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   712322 (CAMK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like FTA2 Kdo DUF1103 Pkinase_fungal YrbL-PhoP_reg APH
Other DBs
NCBI-GeneID: 712322
NCBI-ProteinID: XP_028705477
Ensembl: ENSMMUG00000011974
LinkDB
Position
6
AA seq 473 aa
MLKVTVPSCSASSCSSVTASAAPGTASLVPDYWIDGSNRDALSDFFEVESELGRGATSIV
YRCKQKGTQKPYALKVLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPTEISLVLEL
VTGGELFDRIVEKGYYSERDAADAVKQILEAVAYLHENGIVHRDLKPENLLYATPAPDAP
LKIADFGLSKIVEHQVLMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGIITYILLCGFEP
FYDERGDQFMFRRILNCEYYFISPWWDEVSLNAKDLVRKLIVLDPKKRLTTFQALQHPWV
TGKAANFVHMDTAQKKLQEFNARRKLKAAVKAVVASSRLGSASSSHGNIQESHKASRDPS
PIQDGNEDMKAIPEGEKIQSDGAQAAVKGAQAELMKVQALEKVKGSDINAEEAPRMVPKA
VEDGIKVADLELEKGLAEEKLKTVEEVAAPREGQGSSAVGFDVPQQDVILPEY
NT seq 1422 nt   +upstreamnt  +downstreamnt
atgctcaaagtcacggtgccctcctgctccgcctcgtcctgctcttcggtcaccgccagt
gcggccccggggaccgcgagcctcgtcccggattactggatcgacggctccaacagggat
gcgctgagcgatttcttcgaggtggagtcggagctgggacggggtgctacatccattgtg
tacagatgcaaacagaaggggacccagaagccttatgctctcaaagtgttaaagaaaaca
gtggacaaaaaaatcgtaagaactgagataggagttcttcttcgcctctcacatccaaac
attataaaacttaaagagatatttgaaacccctacagaaatcagtctggtcctagaactc
gtcacaggaggagaactgtttgataggattgtggaaaagggatattacagtgagcgagat
gctgcagatgctgttaaacaaatcctggaggcagtcgcttatctacatgaaaatggaatt
gtccatcgtgatctcaaaccagagaatcttctctatgcaactccagccccagatgcacca
ctcaaaatcgctgattttggactctctaaaattgtggaacatcaagtgctcatgaagaca
gtatgtggaaccccagggtactgcgcacctgaaattcttagaggttgtgcctatggacct
gaggtggacatgtggtctgtaggaataatcacctacatcttactttgtggatttgaacca
ttctatgatgaaagaggcgatcagttcatgttcagaagaattctgaattgtgaatattac
tttatctccccctggtgggatgaagtatctctaaatgccaaggacttggtcagaaaatta
attgttttggatccaaagaaacggctgactacctttcaagctctccagcatccgtgggtc
acaggtaaagcagccaattttgtacacatggataccgctcaaaagaagcttcaagaattc
aatgctcggcgtaagcttaaggcagcggtgaaggctgtggtggcctcttcccggctggga
agtgccagcagcagccatggcaacatccaggagagccacaaggctagccgagacccttct
ccaatccaagacggcaacgaggacatgaaagctattccagaaggagagaaaattcaaagc
gatggggcccaagccgcagttaagggggcacaggctgagctgatgaaggtgcaagcctta
gagaaagttaaaggttcagatataaatgctgaagaggcccccaggatggtgcccaaggca
gtggaggatgggataaaggtggctgacctggaactagagaagggcctagcagaggagaag
ctgaagactgtggaggaagtagcagctcccagggaagggcaaggaagctctgctgtgggc
tttgacgttccacagcaagatgtgatcctgccagagtactaa

KEGG   Macaca mulatta (rhesus monkey): 717624
Entry
717624            CDS       T01028                                 

Gene name
CAMK1G
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type 1G isoform X2
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04020  Calcium signaling pathway
mcc04921  Oxytocin signaling pathway
mcc04925  Aldosterone synthesis and secretion
mcc05214  Glioma
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    717624 (CAMK1G)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    717624 (CAMK1G)
   04925 Aldosterone synthesis and secretion
    717624 (CAMK1G)
 09160 Human Diseases
  09162 Cancer: specific types
   05214 Glioma
    717624 (CAMK1G)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    717624 (CAMK1G)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     717624 (CAMK1G)
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   717624 (CAMK1G)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like FTA2 Kdo Pkinase_fungal RIO1 APH YrbL-PhoP_reg CsgA 5_nucleotid
Other DBs
NCBI-GeneID: 717624
NCBI-ProteinID: XP_014973106
Ensembl: ENSMMUG00000003369
UniProt: G7MEP2 A0A1D5RB51
LinkDB
Position
1
AA seq 476 aa
MGRKEEDDCSSWKKQTTNIRKTFIFMEVLGSGAFSEVFLVKQRLTGKLFALKCIKKSPAF
RDSSLENEIAVLKKIKHENIVTLEDIYESTTHYYLVMQLVSGGELFDRILERGVYTEKDA
SLVIQQVLSAVKYLHENGIVHRDLKPENLLYLTPEENSKIMITDFGLSKMEQNGVMSTAC
GTPGYVAPEVLAQKPYSKAVDCWSIGVITYILLCGYPPFYEETESKLFEKIKEGYYEFES
PFWDDISESAKDFICHLLEKDPNERYTCEKALSHPWIDGNTALHRDIYPSVSLQIQKNFA
KSKWRQAFNAAAVVHHMRKLHMNLHSPGIRPEVENRPPETQASETSRPSSPEITITEAPV
LDQSVALPALTQLPCQHGRRPTAPGGRSLNCLVNGSLRISSSLVPMHQGSLAAGPCGCCS
SCLNIGSKGKSSYCSEPTLIKKANKKQNFKSEVMVPVKASGSSHCRAGQTGVCLIM
NT seq 1431 nt   +upstreamnt  +downstreamnt
atgggtcgaaaggaagaagatgactgcagttcctggaagaaacagaccaccaacatccgg
aaaaccttcatttttatggaagtgctgggatcaggagctttctcagaagtgttcctggtg
aagcaaagactgactgggaagctctttgccctgaagtgcatcaagaagtcacctgctttc
cgtgacagcagtctggagaatgagattgctgtgttgaaaaagatcaagcatgaaaacatt
gtgaccttggaggacatctacgagagcaccacccactactacctggtcatgcagcttgtt
tctggtggggagctctttgaccggatcctggagcggggtgtctacacagagaaggatgcc
agtctggtgatccagcaggtcttgtcggcggtgaaatacctccatgagaatggcatcgtc
cacagagacttaaagcctgaaaaccttttgtaccttacccctgaagagaactctaagatc
atgatcactgactttggtctgtccaagatggaacagaatggcgtcatgtccactgcctgt
gggaccccgggttatgtggctccagaagtgctggcccagaaaccctacagcaaggctgtg
gattgctggtccatcggtgtcatcacctacatattgctctgtggataccccccgttctac
gaagaaacggagtctaagcttttcgagaagatcaaggagggctactatgagtttgagtct
ccattctgggatgacatttctgagtcagccaaggactttatttgccacttgctcgagaag
gatccgaatgagcggtacacctgtgagaaggccttgagtcacccctggattgacgggaac
acagccctccaccgggacatctacccatcagtcagcctccagatccagaagaactttgct
aagagcaagtggaggcaagcgttcaacgcagcagctgtggtgcaccacatgaggaagcta
cacatgaacctgcacagcccgggcatccgcccagaggtggagaacaggccgcctgaaact
caagcctcagaaacctctagacccagctcccctgagatcaccatcactgaggcaccagtc
ctggaccagagcgtagcactccctgctctgacccaattaccctgccagcatggccgccgg
cccactgcccctggtggcaggtccctcaactgcctggtcaacggctccctccgcatcagc
agcagcctggtgcccatgcatcagggatccctggccgccgggccctgtggctgctgctcc
agctgcctgaacattgggagcaaaggaaaatcctcctactgctctgagcccacactcatc
aaaaaggccaacaaaaaacagaacttcaaatcggaggtcatggtaccagttaaagccagc
ggcagctcccactgccgggcagggcagactggagtctgtctcattatgtga

DBGET integrated database retrieval system