KEGG   Macaca mulatta (rhesus monkey): 697712
Entry
697712            CDS       T01028                                 

Gene name
RAB5A
Definition
(RefSeq) ras-related protein Rab-5A
  KO
K07887  Ras-related protein Rab-5A
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04014  Ras signaling pathway
mcc04144  Endocytosis
mcc04145  Phagosome
mcc04962  Vasopressin-regulated water reabsorption
mcc05014  Amyotrophic lateral sclerosis
mcc05022  Pathways of neurodegeneration - multiple diseases
mcc05132  Salmonella infection
mcc05146  Amoebiasis
mcc05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    697712 (RAB5A)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    697712 (RAB5A)
   04145 Phagosome
    697712 (RAB5A)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    697712 (RAB5A)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    697712 (RAB5A)
   05022 Pathways of neurodegeneration - multiple diseases
    697712 (RAB5A)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    697712 (RAB5A)
   05152 Tuberculosis
    697712 (RAB5A)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    697712 (RAB5A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    697712 (RAB5A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    697712 (RAB5A)
   04031 GTP-binding proteins [BR:mcc04031]
    697712 (RAB5A)
Membrane trafficking [BR:mcc04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab GTPases
    697712 (RAB5A)
 Endosome - Lysosome transport
    697712 (RAB5A)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   697712 (RAB5A)
  Exosomal proteins of other body fluids (saliva and urine)
   697712 (RAB5A)
  Exosomal proteins of colorectal cancer cells
   697712 (RAB5A)
  Exosomal proteins of bladder cancer cells
   697712 (RAB5A)
GTP-binding proteins [BR:mcc04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab5/17/22/31 [OT]
    697712 (RAB5A)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 Gtr1_RagA RsgA_GTPase GTP_EFTU AAA_16 MCR_beta BrnT_toxin
Other DBs
NCBI-GeneID: 697712
NCBI-ProteinID: NP_001248077
Ensembl: ENSMMUG00000006992
UniProt: H9EST8
LinkDB
Position
2
AA seq 215 aa
MANRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQ
TVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQR
QASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKK
LPKNEPQNPGANSARGRGVDLTEPTQPTRSQCCSN
NT seq 648 nt   +upstreamnt  +downstreamnt
atggctaatcgaggcgcaacaagacccaacgggccaaatactggaaataaaatatgccag
ttcaaactagtacttctgggagagtctgctgttggcaaatcaagcctagtgcttcgtttt
gtgaaaggccaatttcatgaatttcaagagagtaccattggggctgcttttctaacccaa
actgtatgtcttgatgacactacagtaaagtttgaaatatgggatacagctggtcaagaa
cgataccatagcctagcaccaatgtactacagaggagcacaagcagccatagttgtatat
gatatcacaaatgaggagtcctttgcaagagcaaaaaattgggttaaggaacttcagagg
caagcaagtcctaacattgtaatagctttatcaggaaacaaggccgacctagcaaataaa
agagcagtagatttccaggaagcacagtcctatgcagatgacaatagtttattattcatg
gagacatcagctaaaacatcaatgaatgtaaatgaaatattcatggcaatagctaaaaaa
ttgccaaagaatgaaccacaaaatccaggagcaaattctgccagaggaagaggagtagac
ctcaccgaacccacacaaccaaccaggagtcagtgttgtagtaactaa

KEGG   Macaca mulatta (rhesus monkey): 708347
Entry
708347            CDS       T01028                                 

Gene name
RAB5B
Definition
(RefSeq) ras-related protein Rab-5B
  KO
K07888  Ras-related protein Rab-5B
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04014  Ras signaling pathway
mcc04144  Endocytosis
mcc04145  Phagosome
mcc04962  Vasopressin-regulated water reabsorption
mcc05132  Salmonella infection
mcc05146  Amoebiasis
mcc05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    708347 (RAB5B)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    708347 (RAB5B)
   04145 Phagosome
    708347 (RAB5B)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    708347 (RAB5B)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    708347 (RAB5B)
   05152 Tuberculosis
    708347 (RAB5B)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    708347 (RAB5B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    708347 (RAB5B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    708347 (RAB5B)
   04031 GTP-binding proteins [BR:mcc04031]
    708347 (RAB5B)
Membrane trafficking [BR:mcc04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab GTPases
    708347 (RAB5B)
 Endosome - Lysosome transport
    708347 (RAB5B)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   708347 (RAB5B)
  Exosomal proteins of other body fluids (saliva and urine)
   708347 (RAB5B)
  Exosomal proteins of colorectal cancer cells
   708347 (RAB5B)
  Exosomal proteins of melanoma cells
   708347 (RAB5B)
GTP-binding proteins [BR:mcc04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab5/17/22/31 [OT]
    708347 (RAB5B)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 RsgA_GTPase Gtr1_RagA GTP_EFTU AAA_16
Other DBs
NCBI-GeneID: 708347
NCBI-ProteinID: XP_015007425
Ensembl: ENSMMUG00000031853
UniProt: G7N7A8 A0A663D9F6
LinkDB
Position
11
AA seq 215 aa
MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQ
SVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQR
QASPSIVIALAGNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKK
LPKSEPQNLGGTACRSRGVDLHEQSQQNKSQCCSN
NT seq 648 nt   +upstreamnt  +downstreamnt
atgactagcagaagcacagctaggcccaatgggcaaccccaggccagcaaaatttgccag
ttcaaattggtgctgctgggagaatctgcagtgggaaagtcaagcctggtgttacgtttt
gtcaaagggcagttccatgagtaccaggagagcaccattggagcggccttccttacccag
tccgtttgtctagatgacacaacagtcaagtttgagatctgggacacagctgggcaggag
cgatatcacagcttagcccctatgtactacaggggtgcccaagctgcaatcgtggtttac
gacattactaatcaggaaacctttgcccgagcaaagacatgggtgaaggaactacagcga
caggccagtcctagcatcgttattgccctggcagggaacaaagctgacctggctaacaag
cgtatggtggagtatgaagaggcccaggcatatgcagatgacaacagcttattgttcatg
gagacttcagccaagacggctatgaacgtgaatgatctcttcctggcaatagctaagaag
ttgccaaagagtgaaccccagaatctgggaggtacagcatgccgaagccggggtgtggat
ctccatgaacagtcccagcagaacaagagccagtgttgtagcaactga

KEGG   Macaca mulatta (rhesus monkey): 709308
Entry
709308            CDS       T01028                                 

Gene name
RAB5C
Definition
(RefSeq) ras-related protein Rab-5C
  KO
K07889  Ras-related protein Rab-5C
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04014  Ras signaling pathway
mcc04144  Endocytosis
mcc04145  Phagosome
mcc04962  Vasopressin-regulated water reabsorption
mcc05132  Salmonella infection
mcc05146  Amoebiasis
mcc05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    709308 (RAB5C)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    709308 (RAB5C)
   04145 Phagosome
    709308 (RAB5C)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    709308 (RAB5C)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    709308 (RAB5C)
   05152 Tuberculosis
    709308 (RAB5C)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    709308 (RAB5C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    709308 (RAB5C)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    709308 (RAB5C)
   04031 GTP-binding proteins [BR:mcc04031]
    709308 (RAB5C)
Membrane trafficking [BR:mcc04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab GTPases
    709308 (RAB5C)
 Endosome - Lysosome transport
    709308 (RAB5C)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   709308 (RAB5C)
  Exosomal proteins of other body fluids (saliva and urine)
   709308 (RAB5C)
  Exosomal proteins of colorectal cancer cells
   709308 (RAB5C)
  Exosomal proteins of bladder cancer cells
   709308 (RAB5C)
GTP-binding proteins [BR:mcc04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab5/17/22/31 [OT]
    709308 (RAB5C)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 Gtr1_RagA RsgA_GTPase GTP_EFTU AAA_16
Other DBs
NCBI-GeneID: 709308
NCBI-ProteinID: NP_001253100
Ensembl: ENSMMUG00000014756
UniProt: F7G108 G7NIK5
LinkDB
Position
16
AA seq 216 aa
MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLT
QTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQ
RQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAK
KLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCSN
NT seq 651 nt   +upstreamnt  +downstreamnt
atggcgggtcggggaggcgcagcacgacccaatggaccagccgctgggaacaagatctgt
cagtttaaactggttctgctgggggagtctgcggtgggcaaatccagcctcgtcctccgc
tttgtcaagggacagtttcacgagtaccaggagagcacaatcggagcggccttcctcaca
cagactgtctgcctggatgacacaacagtcaagtttgagatctgggacacagctggacag
gagcggtatcacagcctggcccccatgtactatcggggggctcaggctgccatcgtggtc
tatgacatcaccaacacagatacatttgcacgggccaagaactgggtgaaggagctacag
aggcaggccagccccaacatcgtcattgcactcgcgggtaacaaggcagacctggccagc
aagagagccgtggaattccaggaagcacaagcctatgcagatgacaacagtttgctgttc
atggagacatcagcaaagactgcaatgaacgtgaacgaaatcttcatggcaatagctaag
aagcttcccaagaacgagccccagaatgcaactggtgctccaggccgaaaccgaggtgtg
gacctccaggagaacaacccagccagccggagccagtgctgcagcaactga

DBGET integrated database retrieval system