KEGG   Macaca mulatta (rhesus monkey): 697747
Entry
697747            CDS       T01028                                 

Gene name
AKT1
Definition
(RefSeq) RAC-alpha serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01521  EGFR tyrosine kinase inhibitor resistance
mcc01522  Endocrine resistance
mcc01524  Platinum drug resistance
mcc04010  MAPK signaling pathway
mcc04012  ErbB signaling pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04022  cGMP-PKG signaling pathway
mcc04024  cAMP signaling pathway
mcc04062  Chemokine signaling pathway
mcc04066  HIF-1 signaling pathway
mcc04068  FoxO signaling pathway
mcc04071  Sphingolipid signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04140  Autophagy - animal
mcc04150  mTOR signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04152  AMPK signaling pathway
mcc04210  Apoptosis
mcc04211  Longevity regulating pathway
mcc04213  Longevity regulating pathway - multiple species
mcc04218  Cellular senescence
mcc04261  Adrenergic signaling in cardiomyocytes
mcc04370  VEGF signaling pathway
mcc04371  Apelin signaling pathway
mcc04380  Osteoclast differentiation
mcc04510  Focal adhesion
mcc04550  Signaling pathways regulating pluripotency of stem cells
mcc04611  Platelet activation
mcc04613  Neutrophil extracellular trap formation
mcc04620  Toll-like receptor signaling pathway
mcc04625  C-type lectin receptor signaling pathway
mcc04630  JAK-STAT signaling pathway
mcc04660  T cell receptor signaling pathway
mcc04662  B cell receptor signaling pathway
mcc04664  Fc epsilon RI signaling pathway
mcc04666  Fc gamma R-mediated phagocytosis
mcc04668  TNF signaling pathway
mcc04722  Neurotrophin signaling pathway
mcc04725  Cholinergic synapse
mcc04728  Dopaminergic synapse
mcc04910  Insulin signaling pathway
mcc04914  Progesterone-mediated oocyte maturation
mcc04915  Estrogen signaling pathway
mcc04917  Prolactin signaling pathway
mcc04919  Thyroid hormone signaling pathway
mcc04920  Adipocytokine signaling pathway
mcc04922  Glucagon signaling pathway
mcc04923  Regulation of lipolysis in adipocytes
mcc04926  Relaxin signaling pathway
mcc04929  GnRH secretion
mcc04931  Insulin resistance
mcc04932  Non-alcoholic fatty liver disease
mcc04933  AGE-RAGE signaling pathway in diabetic complications
mcc04935  Growth hormone synthesis, secretion and action
mcc04973  Carbohydrate digestion and absorption
mcc05010  Alzheimer disease
mcc05017  Spinocerebellar ataxia
mcc05132  Salmonella infection
mcc05135  Yersinia infection
mcc05142  Chagas disease
mcc05145  Toxoplasmosis
mcc05152  Tuberculosis
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05162  Measles
mcc05163  Human cytomegalovirus infection
mcc05164  Influenza A
mcc05165  Human papillomavirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05200  Pathways in cancer
mcc05205  Proteoglycans in cancer
mcc05210  Colorectal cancer
mcc05211  Renal cell carcinoma
mcc05212  Pancreatic cancer
mcc05213  Endometrial cancer
mcc05214  Glioma
mcc05215  Prostate cancer
mcc05218  Melanoma
mcc05220  Chronic myeloid leukemia
mcc05221  Acute myeloid leukemia
mcc05222  Small cell lung cancer
mcc05223  Non-small cell lung cancer
mcc05224  Breast cancer
mcc05225  Hepatocellular carcinoma
mcc05226  Gastric cancer
mcc05230  Central carbon metabolism in cancer
mcc05231  Choline metabolism in cancer
mcc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mcc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    697747 (AKT1)
   04012 ErbB signaling pathway
    697747 (AKT1)
   04014 Ras signaling pathway
    697747 (AKT1)
   04015 Rap1 signaling pathway
    697747 (AKT1)
   04370 VEGF signaling pathway
    697747 (AKT1)
   04371 Apelin signaling pathway
    697747 (AKT1)
   04630 JAK-STAT signaling pathway
    697747 (AKT1)
   04668 TNF signaling pathway
    697747 (AKT1)
   04066 HIF-1 signaling pathway
    697747 (AKT1)
   04068 FoxO signaling pathway
    697747 (AKT1)
   04072 Phospholipase D signaling pathway
    697747 (AKT1)
   04071 Sphingolipid signaling pathway
    697747 (AKT1)
   04024 cAMP signaling pathway
    697747 (AKT1)
   04022 cGMP-PKG signaling pathway
    697747 (AKT1)
   04151 PI3K-Akt signaling pathway
    697747 (AKT1)
   04152 AMPK signaling pathway
    697747 (AKT1)
   04150 mTOR signaling pathway
    697747 (AKT1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    697747 (AKT1)
  09143 Cell growth and death
   04210 Apoptosis
    697747 (AKT1)
   04218 Cellular senescence
    697747 (AKT1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    697747 (AKT1)
   04550 Signaling pathways regulating pluripotency of stem cells
    697747 (AKT1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    697747 (AKT1)
   04613 Neutrophil extracellular trap formation
    697747 (AKT1)
   04620 Toll-like receptor signaling pathway
    697747 (AKT1)
   04625 C-type lectin receptor signaling pathway
    697747 (AKT1)
   04660 T cell receptor signaling pathway
    697747 (AKT1)
   04662 B cell receptor signaling pathway
    697747 (AKT1)
   04664 Fc epsilon RI signaling pathway
    697747 (AKT1)
   04666 Fc gamma R-mediated phagocytosis
    697747 (AKT1)
   04062 Chemokine signaling pathway
    697747 (AKT1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    697747 (AKT1)
   04922 Glucagon signaling pathway
    697747 (AKT1)
   04923 Regulation of lipolysis in adipocytes
    697747 (AKT1)
   04920 Adipocytokine signaling pathway
    697747 (AKT1)
   04929 GnRH secretion
    697747 (AKT1)
   04915 Estrogen signaling pathway
    697747 (AKT1)
   04914 Progesterone-mediated oocyte maturation
    697747 (AKT1)
   04917 Prolactin signaling pathway
    697747 (AKT1)
   04926 Relaxin signaling pathway
    697747 (AKT1)
   04935 Growth hormone synthesis, secretion and action
    697747 (AKT1)
   04919 Thyroid hormone signaling pathway
    697747 (AKT1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    697747 (AKT1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    697747 (AKT1)
  09156 Nervous system
   04725 Cholinergic synapse
    697747 (AKT1)
   04728 Dopaminergic synapse
    697747 (AKT1)
   04722 Neurotrophin signaling pathway
    697747 (AKT1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    697747 (AKT1)
  09149 Aging
   04211 Longevity regulating pathway
    697747 (AKT1)
   04213 Longevity regulating pathway - multiple species
    697747 (AKT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    697747 (AKT1)
   05205 Proteoglycans in cancer
    697747 (AKT1)
   05230 Central carbon metabolism in cancer
    697747 (AKT1)
   05231 Choline metabolism in cancer
    697747 (AKT1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    697747 (AKT1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    697747 (AKT1)
   05212 Pancreatic cancer
    697747 (AKT1)
   05225 Hepatocellular carcinoma
    697747 (AKT1)
   05226 Gastric cancer
    697747 (AKT1)
   05214 Glioma
    697747 (AKT1)
   05221 Acute myeloid leukemia
    697747 (AKT1)
   05220 Chronic myeloid leukemia
    697747 (AKT1)
   05218 Melanoma
    697747 (AKT1)
   05211 Renal cell carcinoma
    697747 (AKT1)
   05215 Prostate cancer
    697747 (AKT1)
   05213 Endometrial cancer
    697747 (AKT1)
   05224 Breast cancer
    697747 (AKT1)
   05222 Small cell lung cancer
    697747 (AKT1)
   05223 Non-small cell lung cancer
    697747 (AKT1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    697747 (AKT1)
   05017 Spinocerebellar ataxia
    697747 (AKT1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    697747 (AKT1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    697747 (AKT1)
   04931 Insulin resistance
    697747 (AKT1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    697747 (AKT1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    697747 (AKT1)
   05135 Yersinia infection
    697747 (AKT1)
   05152 Tuberculosis
    697747 (AKT1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    697747 (AKT1)
   05170 Human immunodeficiency virus 1 infection
    697747 (AKT1)
   05161 Hepatitis B
    697747 (AKT1)
   05160 Hepatitis C
    697747 (AKT1)
   05164 Influenza A
    697747 (AKT1)
   05162 Measles
    697747 (AKT1)
   05168 Herpes simplex virus 1 infection
    697747 (AKT1)
   05163 Human cytomegalovirus infection
    697747 (AKT1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    697747 (AKT1)
   05169 Epstein-Barr virus infection
    697747 (AKT1)
   05165 Human papillomavirus infection
    697747 (AKT1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    697747 (AKT1)
   05142 Chagas disease
    697747 (AKT1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    697747 (AKT1)
   01524 Platinum drug resistance
    697747 (AKT1)
   01522 Endocrine resistance
    697747 (AKT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    697747 (AKT1)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     697747 (AKT1)
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   697747 (AKT1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like PH_11 Seadorna_VP7 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 697747
NCBI-ProteinID: NP_001248554
Ensembl: ENSMMUG00000001044
UniProt: G7MWI7 A0A5F7Z7J5
LinkDB
Position
7
AA seq 480 aa
MSDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQREAPLNNFSVAQC
QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKKHEEEMMDF
RSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS
RERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFEL
ILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKK
LSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgagcgacgtggctattgtgaaggagggctggctgcacaaacgaggggagtacatcaag
acctggcgaccacgctacttcctcctcaagaatgatggcactttcattggctataaggag
cggccgcaggacgtggaccaacgtgaggcccccctcaacaacttctctgtggcacagtgc
cagctgatgaagacggagcggccccggcccaacaccttcatcatccgctgcctgcagtgg
accactgtcatcgaacgcaccttccacgtggagactcccgaggagcgggaggagtggaca
accgccatccagacagtggccgatggcctcaagaagcacgaggaggagatgatggacttc
cggtcgggctcacccagcgacaactcaggggctgaagagatggaggtgtccctggccaaa
cccaagcaccgtgtgaccatgaacgagtttgagtacctgaagctgctgggcaagggcact
ttcgggaaggtgatcctggtgaaggagaaggcaacgggccgctactatgccatgaagatc
ctcaagaaggaggtcatcgtggccaaggacgaggtggcccacacactcaccgagaaccgt
gttctgcagaactccaggcaccccttcctcacggccctgaagtactccttccagacccac
gaccgcctctgcttcgtcatggagtacgccaatgggggcgagctcttcttccacctgtcc
cgggagcgtgtgttctctgaggaccgggcccgcttctatggcgccgagatcgtgtcagcc
ctggactacctgcactcggagaagaatgtggtgtaccgggacctcaagctggagaacctc
atgctggacaaggacgggcacattaagatcacagacttcgggctgtgcaaggaggggatc
aaggatggcgccaccatgaagaccttctgcggcacacctgagtacctggcccctgaggtg
ctggaggacaatgactacggccgtgcggtggactggtgggggctgggcgtggtcatgtat
gagatgatgtgcggccgcctgcccttctacaaccaggaccacgagaagctttttgagctc
atcctcatggaggagatccgcttcccgcgcacgcttggtcctgaggccaagtccttgctc
tcagggctgctcaagaaggaccccaagcagaggcttggcgggggctctgaggacgccaag
gagatcatgcagcatcgcttctttgccggcatcgtgtggcagcacgtgtatgagaagaag
ctcagcccacccttcaagccccaggtcacatcggagaccgacaccaggtattttgatgag
gagttcacggcccagatgatcaccatcacaccacctgaccaagacgacagcatggagtgc
gtggacagcgagcgcaggccccacttcccccagttctcctactcggccagcggcacggcc
tga

KEGG   Macaca mulatta (rhesus monkey): 700591
Entry
700591            CDS       T01028                                 

Gene name
AKT2
Definition
(RefSeq) RAC-beta serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01521  EGFR tyrosine kinase inhibitor resistance
mcc01522  Endocrine resistance
mcc01524  Platinum drug resistance
mcc04010  MAPK signaling pathway
mcc04012  ErbB signaling pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04022  cGMP-PKG signaling pathway
mcc04024  cAMP signaling pathway
mcc04062  Chemokine signaling pathway
mcc04066  HIF-1 signaling pathway
mcc04068  FoxO signaling pathway
mcc04071  Sphingolipid signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04140  Autophagy - animal
mcc04150  mTOR signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04152  AMPK signaling pathway
mcc04210  Apoptosis
mcc04211  Longevity regulating pathway
mcc04213  Longevity regulating pathway - multiple species
mcc04218  Cellular senescence
mcc04261  Adrenergic signaling in cardiomyocytes
mcc04370  VEGF signaling pathway
mcc04371  Apelin signaling pathway
mcc04380  Osteoclast differentiation
mcc04510  Focal adhesion
mcc04550  Signaling pathways regulating pluripotency of stem cells
mcc04611  Platelet activation
mcc04613  Neutrophil extracellular trap formation
mcc04620  Toll-like receptor signaling pathway
mcc04625  C-type lectin receptor signaling pathway
mcc04630  JAK-STAT signaling pathway
mcc04660  T cell receptor signaling pathway
mcc04662  B cell receptor signaling pathway
mcc04664  Fc epsilon RI signaling pathway
mcc04666  Fc gamma R-mediated phagocytosis
mcc04668  TNF signaling pathway
mcc04722  Neurotrophin signaling pathway
mcc04725  Cholinergic synapse
mcc04728  Dopaminergic synapse
mcc04910  Insulin signaling pathway
mcc04914  Progesterone-mediated oocyte maturation
mcc04915  Estrogen signaling pathway
mcc04917  Prolactin signaling pathway
mcc04919  Thyroid hormone signaling pathway
mcc04920  Adipocytokine signaling pathway
mcc04922  Glucagon signaling pathway
mcc04923  Regulation of lipolysis in adipocytes
mcc04926  Relaxin signaling pathway
mcc04929  GnRH secretion
mcc04931  Insulin resistance
mcc04932  Non-alcoholic fatty liver disease
mcc04933  AGE-RAGE signaling pathway in diabetic complications
mcc04935  Growth hormone synthesis, secretion and action
mcc04973  Carbohydrate digestion and absorption
mcc05010  Alzheimer disease
mcc05017  Spinocerebellar ataxia
mcc05132  Salmonella infection
mcc05135  Yersinia infection
mcc05142  Chagas disease
mcc05145  Toxoplasmosis
mcc05152  Tuberculosis
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05162  Measles
mcc05163  Human cytomegalovirus infection
mcc05164  Influenza A
mcc05165  Human papillomavirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05200  Pathways in cancer
mcc05205  Proteoglycans in cancer
mcc05210  Colorectal cancer
mcc05211  Renal cell carcinoma
mcc05212  Pancreatic cancer
mcc05213  Endometrial cancer
mcc05214  Glioma
mcc05215  Prostate cancer
mcc05218  Melanoma
mcc05220  Chronic myeloid leukemia
mcc05221  Acute myeloid leukemia
mcc05222  Small cell lung cancer
mcc05223  Non-small cell lung cancer
mcc05224  Breast cancer
mcc05225  Hepatocellular carcinoma
mcc05226  Gastric cancer
mcc05230  Central carbon metabolism in cancer
mcc05231  Choline metabolism in cancer
mcc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mcc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    700591 (AKT2)
   04012 ErbB signaling pathway
    700591 (AKT2)
   04014 Ras signaling pathway
    700591 (AKT2)
   04015 Rap1 signaling pathway
    700591 (AKT2)
   04370 VEGF signaling pathway
    700591 (AKT2)
   04371 Apelin signaling pathway
    700591 (AKT2)
   04630 JAK-STAT signaling pathway
    700591 (AKT2)
   04668 TNF signaling pathway
    700591 (AKT2)
   04066 HIF-1 signaling pathway
    700591 (AKT2)
   04068 FoxO signaling pathway
    700591 (AKT2)
   04072 Phospholipase D signaling pathway
    700591 (AKT2)
   04071 Sphingolipid signaling pathway
    700591 (AKT2)
   04024 cAMP signaling pathway
    700591 (AKT2)
   04022 cGMP-PKG signaling pathway
    700591 (AKT2)
   04151 PI3K-Akt signaling pathway
    700591 (AKT2)
   04152 AMPK signaling pathway
    700591 (AKT2)
   04150 mTOR signaling pathway
    700591 (AKT2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    700591 (AKT2)
  09143 Cell growth and death
   04210 Apoptosis
    700591 (AKT2)
   04218 Cellular senescence
    700591 (AKT2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    700591 (AKT2)
   04550 Signaling pathways regulating pluripotency of stem cells
    700591 (AKT2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    700591 (AKT2)
   04613 Neutrophil extracellular trap formation
    700591 (AKT2)
   04620 Toll-like receptor signaling pathway
    700591 (AKT2)
   04625 C-type lectin receptor signaling pathway
    700591 (AKT2)
   04660 T cell receptor signaling pathway
    700591 (AKT2)
   04662 B cell receptor signaling pathway
    700591 (AKT2)
   04664 Fc epsilon RI signaling pathway
    700591 (AKT2)
   04666 Fc gamma R-mediated phagocytosis
    700591 (AKT2)
   04062 Chemokine signaling pathway
    700591 (AKT2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    700591 (AKT2)
   04922 Glucagon signaling pathway
    700591 (AKT2)
   04923 Regulation of lipolysis in adipocytes
    700591 (AKT2)
   04920 Adipocytokine signaling pathway
    700591 (AKT2)
   04929 GnRH secretion
    700591 (AKT2)
   04915 Estrogen signaling pathway
    700591 (AKT2)
   04914 Progesterone-mediated oocyte maturation
    700591 (AKT2)
   04917 Prolactin signaling pathway
    700591 (AKT2)
   04926 Relaxin signaling pathway
    700591 (AKT2)
   04935 Growth hormone synthesis, secretion and action
    700591 (AKT2)
   04919 Thyroid hormone signaling pathway
    700591 (AKT2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    700591 (AKT2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    700591 (AKT2)
  09156 Nervous system
   04725 Cholinergic synapse
    700591 (AKT2)
   04728 Dopaminergic synapse
    700591 (AKT2)
   04722 Neurotrophin signaling pathway
    700591 (AKT2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    700591 (AKT2)
  09149 Aging
   04211 Longevity regulating pathway
    700591 (AKT2)
   04213 Longevity regulating pathway - multiple species
    700591 (AKT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    700591 (AKT2)
   05205 Proteoglycans in cancer
    700591 (AKT2)
   05230 Central carbon metabolism in cancer
    700591 (AKT2)
   05231 Choline metabolism in cancer
    700591 (AKT2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    700591 (AKT2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    700591 (AKT2)
   05212 Pancreatic cancer
    700591 (AKT2)
   05225 Hepatocellular carcinoma
    700591 (AKT2)
   05226 Gastric cancer
    700591 (AKT2)
   05214 Glioma
    700591 (AKT2)
   05221 Acute myeloid leukemia
    700591 (AKT2)
   05220 Chronic myeloid leukemia
    700591 (AKT2)
   05218 Melanoma
    700591 (AKT2)
   05211 Renal cell carcinoma
    700591 (AKT2)
   05215 Prostate cancer
    700591 (AKT2)
   05213 Endometrial cancer
    700591 (AKT2)
   05224 Breast cancer
    700591 (AKT2)
   05222 Small cell lung cancer
    700591 (AKT2)
   05223 Non-small cell lung cancer
    700591 (AKT2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    700591 (AKT2)
   05017 Spinocerebellar ataxia
    700591 (AKT2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    700591 (AKT2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    700591 (AKT2)
   04931 Insulin resistance
    700591 (AKT2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    700591 (AKT2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    700591 (AKT2)
   05135 Yersinia infection
    700591 (AKT2)
   05152 Tuberculosis
    700591 (AKT2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    700591 (AKT2)
   05170 Human immunodeficiency virus 1 infection
    700591 (AKT2)
   05161 Hepatitis B
    700591 (AKT2)
   05160 Hepatitis C
    700591 (AKT2)
   05164 Influenza A
    700591 (AKT2)
   05162 Measles
    700591 (AKT2)
   05168 Herpes simplex virus 1 infection
    700591 (AKT2)
   05163 Human cytomegalovirus infection
    700591 (AKT2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    700591 (AKT2)
   05169 Epstein-Barr virus infection
    700591 (AKT2)
   05165 Human papillomavirus infection
    700591 (AKT2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    700591 (AKT2)
   05142 Chagas disease
    700591 (AKT2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    700591 (AKT2)
   01524 Platinum drug resistance
    700591 (AKT2)
   01522 Endocrine resistance
    700591 (AKT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    700591 (AKT2)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     700591 (AKT2)
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   700591 (AKT2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C
Other DBs
NCBI-GeneID: 700591
NCBI-ProteinID: NP_001252918
Ensembl: ENSMMUG00000003621
UniProt: F6XQD8 G7NNM2
LinkDB
Position
19
AA seq 481 aa
MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAEC
QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLKQRAPGEDPM
DYKCGSPSDSSAAEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAM
KILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFH
LSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG
ISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFE
LILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQK
KLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGLLELDQRTHFPQFSYSASIR
E
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgaacgaggtgtctgtcatcaaagaaggctggctccacaagcgcggtgaatacatcaag
acctggaggccacggtacttcctgctgaagagcgacggctccttcattgggtacaaggag
aggcccgaggcccctgatcagacccttccccccttaaacaacttctctgtagcagaatgc
cagctgatgaagaccgagaggccgcggcccaacaccttcgtcatacgctgcctgcagtgg
accacagtcatcgagaggaccttccacgtggattctccagacgagagggaggaatggatg
cgggccatccagatggttgccaacagcctcaagcagcgggccccaggtgaggaccccatg
gactacaagtgtggctcccccagtgactcctccgcggccgaggagatggaagtggcggtc
agcaaggcacgggctaaagtgaccatgaatgatttcgactatctcaaactccttggcaag
ggaacctttggcaaagtcatcctggtgcgggagaaggccactggccgctactacgccatg
aagatcctgcggaaggaagtcatcattgccaaggatgaagtcgctcacacagtcaccgag
agccgggtcctccagaacaccaggcacccgttcctcactgcgctgaagtacgccttccag
acccacgaccgcctgtgcttcgtgatggagtacgccaatggtggcgagctgttcttccac
ctgtcccgggagcgtgtcttcacagaggagcgggcccggttttatggtgcagagatcgtc
tcggctcttgagtacttgcactcgcgggacgtggtgtaccgcgacatcaagctggaaaac
ctcatgctggacaaagacggccacatcaagatcactgactttggcctctgcaaagaaggc
atcagtgacggggctaccatgaaaaccttctgtgggaccccggagtacctggcgcctgag
gtgctggaggacaatgactatggccgggccgtggactggtgggggctgggtgtggtcatg
tacgagatgatgtgcggccgcctgcctttctacaaccaggaccacgagcgcctcttcgag
ctcatcctcatggaagagatccgcttcccgcgcacgctcagccccgaggccaagtccctg
cttgccgggctgcttaagaaggaccccaagcagaggcttggtggggggcccagcgatgcc
aaggaggtcatggagcacaggttcttcctcagcatcaactggcaggacgtggtccagaag
aagctcctgccacccttcaaacctcaggtcacgtccgaggtcgacacaaggtactttgat
gatgaattcaccgcccagtccatcacaatcacaccccccgaccgctatgacagcctgggc
ttactggagctggaccagcggacccacttcccccagttctcctactcggccagcatccgc
gagtga

KEGG   Macaca mulatta (rhesus monkey): 714717
Entry
714717            CDS       T01028                                 

Gene name
AKT3
Definition
(RefSeq) RAC-gamma serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01521  EGFR tyrosine kinase inhibitor resistance
mcc01522  Endocrine resistance
mcc01524  Platinum drug resistance
mcc04010  MAPK signaling pathway
mcc04012  ErbB signaling pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04022  cGMP-PKG signaling pathway
mcc04024  cAMP signaling pathway
mcc04062  Chemokine signaling pathway
mcc04066  HIF-1 signaling pathway
mcc04068  FoxO signaling pathway
mcc04071  Sphingolipid signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04140  Autophagy - animal
mcc04150  mTOR signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04152  AMPK signaling pathway
mcc04210  Apoptosis
mcc04211  Longevity regulating pathway
mcc04213  Longevity regulating pathway - multiple species
mcc04218  Cellular senescence
mcc04261  Adrenergic signaling in cardiomyocytes
mcc04370  VEGF signaling pathway
mcc04371  Apelin signaling pathway
mcc04380  Osteoclast differentiation
mcc04510  Focal adhesion
mcc04550  Signaling pathways regulating pluripotency of stem cells
mcc04611  Platelet activation
mcc04613  Neutrophil extracellular trap formation
mcc04620  Toll-like receptor signaling pathway
mcc04625  C-type lectin receptor signaling pathway
mcc04630  JAK-STAT signaling pathway
mcc04660  T cell receptor signaling pathway
mcc04662  B cell receptor signaling pathway
mcc04664  Fc epsilon RI signaling pathway
mcc04666  Fc gamma R-mediated phagocytosis
mcc04668  TNF signaling pathway
mcc04722  Neurotrophin signaling pathway
mcc04725  Cholinergic synapse
mcc04728  Dopaminergic synapse
mcc04910  Insulin signaling pathway
mcc04914  Progesterone-mediated oocyte maturation
mcc04915  Estrogen signaling pathway
mcc04917  Prolactin signaling pathway
mcc04919  Thyroid hormone signaling pathway
mcc04920  Adipocytokine signaling pathway
mcc04922  Glucagon signaling pathway
mcc04923  Regulation of lipolysis in adipocytes
mcc04926  Relaxin signaling pathway
mcc04929  GnRH secretion
mcc04931  Insulin resistance
mcc04932  Non-alcoholic fatty liver disease
mcc04933  AGE-RAGE signaling pathway in diabetic complications
mcc04935  Growth hormone synthesis, secretion and action
mcc04973  Carbohydrate digestion and absorption
mcc05010  Alzheimer disease
mcc05017  Spinocerebellar ataxia
mcc05132  Salmonella infection
mcc05135  Yersinia infection
mcc05142  Chagas disease
mcc05145  Toxoplasmosis
mcc05152  Tuberculosis
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05162  Measles
mcc05163  Human cytomegalovirus infection
mcc05164  Influenza A
mcc05165  Human papillomavirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05200  Pathways in cancer
mcc05205  Proteoglycans in cancer
mcc05210  Colorectal cancer
mcc05211  Renal cell carcinoma
mcc05212  Pancreatic cancer
mcc05213  Endometrial cancer
mcc05214  Glioma
mcc05215  Prostate cancer
mcc05218  Melanoma
mcc05220  Chronic myeloid leukemia
mcc05221  Acute myeloid leukemia
mcc05222  Small cell lung cancer
mcc05223  Non-small cell lung cancer
mcc05224  Breast cancer
mcc05225  Hepatocellular carcinoma
mcc05226  Gastric cancer
mcc05230  Central carbon metabolism in cancer
mcc05231  Choline metabolism in cancer
mcc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mcc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    714717 (AKT3)
   04012 ErbB signaling pathway
    714717 (AKT3)
   04014 Ras signaling pathway
    714717 (AKT3)
   04015 Rap1 signaling pathway
    714717 (AKT3)
   04370 VEGF signaling pathway
    714717 (AKT3)
   04371 Apelin signaling pathway
    714717 (AKT3)
   04630 JAK-STAT signaling pathway
    714717 (AKT3)
   04668 TNF signaling pathway
    714717 (AKT3)
   04066 HIF-1 signaling pathway
    714717 (AKT3)
   04068 FoxO signaling pathway
    714717 (AKT3)
   04072 Phospholipase D signaling pathway
    714717 (AKT3)
   04071 Sphingolipid signaling pathway
    714717 (AKT3)
   04024 cAMP signaling pathway
    714717 (AKT3)
   04022 cGMP-PKG signaling pathway
    714717 (AKT3)
   04151 PI3K-Akt signaling pathway
    714717 (AKT3)
   04152 AMPK signaling pathway
    714717 (AKT3)
   04150 mTOR signaling pathway
    714717 (AKT3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    714717 (AKT3)
  09143 Cell growth and death
   04210 Apoptosis
    714717 (AKT3)
   04218 Cellular senescence
    714717 (AKT3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    714717 (AKT3)
   04550 Signaling pathways regulating pluripotency of stem cells
    714717 (AKT3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    714717 (AKT3)
   04613 Neutrophil extracellular trap formation
    714717 (AKT3)
   04620 Toll-like receptor signaling pathway
    714717 (AKT3)
   04625 C-type lectin receptor signaling pathway
    714717 (AKT3)
   04660 T cell receptor signaling pathway
    714717 (AKT3)
   04662 B cell receptor signaling pathway
    714717 (AKT3)
   04664 Fc epsilon RI signaling pathway
    714717 (AKT3)
   04666 Fc gamma R-mediated phagocytosis
    714717 (AKT3)
   04062 Chemokine signaling pathway
    714717 (AKT3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    714717 (AKT3)
   04922 Glucagon signaling pathway
    714717 (AKT3)
   04923 Regulation of lipolysis in adipocytes
    714717 (AKT3)
   04920 Adipocytokine signaling pathway
    714717 (AKT3)
   04929 GnRH secretion
    714717 (AKT3)
   04915 Estrogen signaling pathway
    714717 (AKT3)
   04914 Progesterone-mediated oocyte maturation
    714717 (AKT3)
   04917 Prolactin signaling pathway
    714717 (AKT3)
   04926 Relaxin signaling pathway
    714717 (AKT3)
   04935 Growth hormone synthesis, secretion and action
    714717 (AKT3)
   04919 Thyroid hormone signaling pathway
    714717 (AKT3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    714717 (AKT3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    714717 (AKT3)
  09156 Nervous system
   04725 Cholinergic synapse
    714717 (AKT3)
   04728 Dopaminergic synapse
    714717 (AKT3)
   04722 Neurotrophin signaling pathway
    714717 (AKT3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    714717 (AKT3)
  09149 Aging
   04211 Longevity regulating pathway
    714717 (AKT3)
   04213 Longevity regulating pathway - multiple species
    714717 (AKT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    714717 (AKT3)
   05205 Proteoglycans in cancer
    714717 (AKT3)
   05230 Central carbon metabolism in cancer
    714717 (AKT3)
   05231 Choline metabolism in cancer
    714717 (AKT3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    714717 (AKT3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    714717 (AKT3)
   05212 Pancreatic cancer
    714717 (AKT3)
   05225 Hepatocellular carcinoma
    714717 (AKT3)
   05226 Gastric cancer
    714717 (AKT3)
   05214 Glioma
    714717 (AKT3)
   05221 Acute myeloid leukemia
    714717 (AKT3)
   05220 Chronic myeloid leukemia
    714717 (AKT3)
   05218 Melanoma
    714717 (AKT3)
   05211 Renal cell carcinoma
    714717 (AKT3)
   05215 Prostate cancer
    714717 (AKT3)
   05213 Endometrial cancer
    714717 (AKT3)
   05224 Breast cancer
    714717 (AKT3)
   05222 Small cell lung cancer
    714717 (AKT3)
   05223 Non-small cell lung cancer
    714717 (AKT3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    714717 (AKT3)
   05017 Spinocerebellar ataxia
    714717 (AKT3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    714717 (AKT3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    714717 (AKT3)
   04931 Insulin resistance
    714717 (AKT3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    714717 (AKT3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    714717 (AKT3)
   05135 Yersinia infection
    714717 (AKT3)
   05152 Tuberculosis
    714717 (AKT3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    714717 (AKT3)
   05170 Human immunodeficiency virus 1 infection
    714717 (AKT3)
   05161 Hepatitis B
    714717 (AKT3)
   05160 Hepatitis C
    714717 (AKT3)
   05164 Influenza A
    714717 (AKT3)
   05162 Measles
    714717 (AKT3)
   05168 Herpes simplex virus 1 infection
    714717 (AKT3)
   05163 Human cytomegalovirus infection
    714717 (AKT3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    714717 (AKT3)
   05169 Epstein-Barr virus infection
    714717 (AKT3)
   05165 Human papillomavirus infection
    714717 (AKT3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    714717 (AKT3)
   05142 Chagas disease
    714717 (AKT3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    714717 (AKT3)
   01524 Platinum drug resistance
    714717 (AKT3)
   01522 Endocrine resistance
    714717 (AKT3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    714717 (AKT3)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     714717 (AKT3)
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   714717 (AKT3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like FTA2 PH_11
Other DBs
NCBI-GeneID: 714717
NCBI-ProteinID: NP_001253569
Ensembl: ENSMMUG00000019995
UniProt: H9FNA9
LinkDB
Position
1
AA seq 479 aa
MSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCS
PTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDA
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILM
EDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVP
PFKPQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMDCMDNERRPHFPQFSYSASGRE
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgagcgatgttaccattgtgaaagaaggttgggttcagaagaggggagaatatataaaa
aactggaggccaagatatttccttttgaagacagatggctcattcataggatataaagag
aaacctcaagatgtggatttaccttatcccctcaacaacttttcagtggcaaaatgccaa
ttaatgaaaacagaacgaccaaagccaaacacatttataatcagatgtctccagtggacc
actgttatagagagaacatttcatgtagatactccagaggaaagggaagaatggacagaa
gctatccaggctgtagcggacagactgcagaggcaagaagaggagagaatgaattgtagt
ccaacttcacaaattgataatataggagaggaagagatggatgcttctacaacccatcat
aaaagaaagacaatgaatgattttgactatttgaaactactaggtaaaggcacttttggg
aaagttattttggttcgagagaaggcaagtggaaaatattatgctatgaagattctgaag
aaagaagtcattattgcaaaggatgaagtggcacacactcttactgaaagcagagtatta
aagaacactagacatccctttttaacatccttgaaatattccttccagacaaaagaccgt
ttgtgttttgtgatggaatatgttaatgggggcgagctgtttttccatttgtcgagagag
cgggtgttctctgaggaccgcacacgtttctatggtgcagaaattgtctctgccttggac
tatctacattccggaaagatcgtgtaccgtgatctcaagttggagaatctaatgctggat
aaagatggccacataaaaattacagattttggactttgcaaagaagggatcacagatgca
gccaccatgaagacgttctgtggcactccagaatatctggcaccagaggtgttagaagat
aatgactatggccgagcagtagactggtggggcctaggggttgtcatgtatgaaatgatg
tgtgggaggttacctttctacaaccaggaccatgagaaactttttgaattaatattaatg
gaagacattaagtttcctcgaacactctcttcagatgcaaaatcattgctttcagggctc
ttgataaaggatccaaataaacgccttggtggaggaccagatgatgcaaaagaaattatg
agacacagtttcttttctggagtaaactggcaagatgtatatgataaaaagcttgtacct
ccttttaaacctcaagtaacatctgagacagatactagatattttgatgaagaatttaca
gctcagactattacaataacaccacctgaaaaatatgatgaggatggtatggactgcatg
gacaatgagaggcggccgcatttccctcagttttcctactctgcaagtggacgagaataa

DBGET integrated database retrieval system