KEGG   Macaca mulatta (rhesus monkey): 697796
Entry
697796            CDS       T01028                                 

Gene name
DRD1
Definition
(RefSeq) D(1A) dopamine receptor
  KO
K04144  dopamine receptor D1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04020  Calcium signaling pathway
mcc04024  cAMP signaling pathway
mcc04080  Neuroactive ligand-receptor interaction
mcc04540  Gap junction
mcc04728  Dopaminergic synapse
mcc05012  Parkinson disease
mcc05030  Cocaine addiction
mcc05031  Amphetamine addiction
mcc05032  Morphine addiction
mcc05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    697796 (DRD1)
   04024 cAMP signaling pathway
    697796 (DRD1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    697796 (DRD1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    697796 (DRD1)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    697796 (DRD1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    697796 (DRD1)
  09165 Substance dependence
   05030 Cocaine addiction
    697796 (DRD1)
   05031 Amphetamine addiction
    697796 (DRD1)
   05032 Morphine addiction
    697796 (DRD1)
   05034 Alcoholism
    697796 (DRD1)
G protein-coupled receptors [BR:mcc04030]
 Rhodopsin family
  Biogenic amine
   Dopamine
    697796 (DRD1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 697796
NCBI-ProteinID: NP_001193904
Ensembl: ENSMMUG00000005147
UniProt: O77680 G7MU06 H9EPW7
LinkDB
Position
6
AA seq 446 aa
MRTLNTSAMDGTGLVVERDFSVRILTACFLSLLILSTLLGNTLVCAAVIRFRHLRSKVTN
FFVISLAVSDLLVAVLVMPWKAVAEIAGFWPFGSFCNIWVAFDIMCSTASILNLCVISVD
RYWAISSPFRYERKMTPKAAFILISVAWTLSVLISFIPVQLSWHKAKPTSPSDGNATSLA
ETIDNCDSSLSRTYAISSSVISFYIPVAIMIVTYTRIYRIAQKQIRRIAALERAAVHAKN
CQTTTGNGKPVECSQPESSFKMSFKRETKVLKTLSVIMGVFVCCWLPFFILNCILPFCGS
GETQPFCIDSITFDVFVWFGWANSSLNPIIYAFNADFRKAFSTLLGCYRLCPATNNAIET
VSINNNGAAMFSSHHEPRGSISKECNLVYLIPHAVGSSEDLKKEEAAGIARPLEKLSPAL
SVILDYDTDVSLEKIQPITQNGQHPT
NT seq 1341 nt   +upstreamnt  +downstreamnt
atgaggactctgaacacctctgccatggacgggactgggctggtggtggagagggacttc
tctgttcgtatcctcactgcctgtttcctgtcgctgctcatcctgtccacgctcctgggg
aacacgctggtctgtgctgccgttatcaggttccgacacctgcggtccaaggttaccaac
ttctttgtcatctccttggccgtgtcagacctcttggtggccgtcttggtcatgccctgg
aaagcagtggctgagattgctggcttctggccctttgggtccttctgtaacatctgggtg
gcctttgacatcatgtgctccaccgcgtccatcctcaacctctgtgtgatcagcgtggac
aggtactgggctatctccagccctttccggtatgagagaaagatgacccccaaggcagcc
ttcatcctgatcagtgtggcatggaccttgtctgtactcatctccttcatcccagtgcag
ctcagctggcacaaggcaaaacccaccagcccctctgatgggaatgccacttccctggct
gagaccatagacaactgtgattccagcctcagcaggacatatgccatctcatcctctgta
ataagtttttacatccctgtggccatcatgattgtcacgtacaccaggatctacaggatt
gctcagaaacaaatacggcgcattgcggccttggagagggcagcagtccatgccaagaat
tgccagaccaccacaggtaatggaaagcctgtcgaatgttctcaaccggaaagttctttt
aagatgtccttcaaaagagaaactaaagtcctgaagactctgtcagtgatcatgggcgtg
tttgtgtgctgttggctacctttcttcatcctgaactgcattttgccgttctgcgggtct
ggggagacgcagcccttctgcatcgattccatcacctttgacgtgtttgtgtggtttggg
tgggctaattcatccttgaaccccatcatttatgcctttaatgctgattttcggaaggca
ttttcaaccctcttaggatgctacagactttgcccggcgacaaataatgccatagagacg
gtgagtatcaataacaatggggccgcgatgttttccagccatcacgagccacgaggttct
atctccaaggagtgcaatctggtttacctgatcccacatgctgtgggctcctctgaggac
ctgaaaaaggaggaggcagctggaatcgccagacccttggagaagctgtccccagcccta
tcggtcatattggactatgacactgacgtctctctggagaagatccaacccatcacacaa
aacggacagcacccaacttga

DBGET integrated database retrieval system