KEGG   Macaca mulatta (rhesus monkey): 697814
Entry
697814            CDS       T01028                                 

Gene name
CD247
Definition
(RefSeq) T-cell surface glycoprotein CD3 zeta chain precursor
  KO
K06453  CD3Z antigen, zeta polypeptide
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04650  Natural killer cell mediated cytotoxicity
mcc04658  Th1 and Th2 cell differentiation
mcc04659  Th17 cell differentiation
mcc04660  T cell receptor signaling pathway
mcc05142  Chagas disease
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    697814 (CD247)
   04660 T cell receptor signaling pathway
    697814 (CD247)
   04658 Th1 and Th2 cell differentiation
    697814 (CD247)
   04659 Th17 cell differentiation
    697814 (CD247)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    697814 (CD247)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    697814 (CD247)
   05169 Epstein-Barr virus infection
    697814 (CD247)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    697814 (CD247)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   697814 (CD247)
CD molecules [BR:mcc04090]
 Proteins
  697814 (CD247)
SSDB
Motif
Pfam: ITAM TCR_zetazeta
Other DBs
NCBI-GeneID: 697814
NCBI-ProteinID: NP_001070891
Ensembl: ENSMMUG00000008158
UniProt: Q09TJ7
LinkDB
Position
1
AA seq 165 aa
MKWKALFTAAILQAQFPITEAQSFGLLDPKLCYLLDGILFLYGVILTALFLRAKFSRSAD
APAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNALQKDKMAE
AYSEIGMKGENQRRRGKGHDGLYQGLSTATKDTYDALHMQTLPPR
NT seq 498 nt   +upstreamnt  +downstreamnt
atgaagtggaaggcgcttttcaccgcagccatcctgcaggcacagttcccaattacagag
gcacagagcttcggcctgctggatcccaaactctgctacctgctggatggaatcctcttc
ctctatggcgtcattctcactgccctgttcctgagagcgaagttcagcaggagcgcagac
gcccccgcgtaccagcagggccagaaccagctctataacgagctcaatctaggacgaaga
gaggagtacgatgttttggacaagagacgcggccgggaccctgagatggggggaaagccg
agaaggaagaaccctcaggaaggcctgtacaatgcactgcagaaagataagatggcggag
gcctacagtgagattgggatgaaaggcgagaaccagcgccggaggggcaaggggcacgat
ggcctttaccaggggctcagtacagccaccaaggacacctatgacgcccttcacatgcag
accctgccccctcgctaa

DBGET integrated database retrieval system