KEGG   Macaca mulatta (rhesus monkey): 698089
Entry
698089            CDS       T01028                                 

Gene name
NFATC1
Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 1 isoform X2
  KO
K04446  nuclear factor of activated T-cells, cytoplasmic 1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04010  MAPK signaling pathway
mcc04022  cGMP-PKG signaling pathway
mcc04024  cAMP signaling pathway
mcc04218  Cellular senescence
mcc04310  Wnt signaling pathway
mcc04380  Osteoclast differentiation
mcc04625  C-type lectin receptor signaling pathway
mcc04650  Natural killer cell mediated cytotoxicity
mcc04658  Th1 and Th2 cell differentiation
mcc04659  Th17 cell differentiation
mcc04660  T cell receptor signaling pathway
mcc04662  B cell receptor signaling pathway
mcc04921  Oxytocin signaling pathway
mcc04933  AGE-RAGE signaling pathway in diabetic complications
mcc05135  Yersinia infection
mcc05161  Hepatitis B
mcc05163  Human cytomegalovirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mcc05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    698089 (NFATC1)
   04310 Wnt signaling pathway
    698089 (NFATC1)
   04024 cAMP signaling pathway
    698089 (NFATC1)
   04022 cGMP-PKG signaling pathway
    698089 (NFATC1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    698089 (NFATC1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    698089 (NFATC1)
   04650 Natural killer cell mediated cytotoxicity
    698089 (NFATC1)
   04660 T cell receptor signaling pathway
    698089 (NFATC1)
   04658 Th1 and Th2 cell differentiation
    698089 (NFATC1)
   04659 Th17 cell differentiation
    698089 (NFATC1)
   04662 B cell receptor signaling pathway
    698089 (NFATC1)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    698089 (NFATC1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    698089 (NFATC1)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    698089 (NFATC1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    698089 (NFATC1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    698089 (NFATC1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    698089 (NFATC1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    698089 (NFATC1)
   05170 Human immunodeficiency virus 1 infection
    698089 (NFATC1)
   05161 Hepatitis B
    698089 (NFATC1)
   05163 Human cytomegalovirus infection
    698089 (NFATC1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    698089 (NFATC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcc03000]
    698089 (NFATC1)
Transcription factors [BR:mcc03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    698089 (NFATC1)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer TIG
Other DBs
NCBI-GeneID: 698089
NCBI-ProteinID: XP_001088054
Ensembl: ENSMMUG00000022596
UniProt: F6Z7T2
LinkDB
Position
18
AA seq 930 aa
MTGLEDQEFDFEFLFEFNQRDEGAAAAAPEHYGYASSNVSPALPLPTAHSTLPAPCHNLQ
TSTPGIVQPADHPSGYGAALDGGPTGYFLSSGHARPDGAPALESPRIEITSCLGLYHNNN
QFFHDVEVEDVLPSSKRSPSTATLSLPSLEAYRDPSCLSPASSLSSRSCNSEASSYESNY
SYPYASPQTSPWQSPCVSPKTTDPEEGFPRGLGACTLLGSPRHSPSTSPRASVTEESWLG
ARSSRPASPCNKRKYSLNGRQPPYSPHHSPTPSPHGSPRVSVTDDSWLGNTTQYTSSAIV
AAINALTTDSSLDLGDGVPVKSRKTTLEQPPSVALKVEPVGEDLGSPPPPADFAPEDFSS
FQHIRKGGFCDQYLAVPQHPYQWAKPKPLSPASYMSPTLPALDWQLPSHSGPYELRIEVQ
PKSHHRAHYETEGSRGAVKASAGGHPIVQLHGYLESEPLMLQLFIGTADDRLLRPHAFYQ
VHRITGKTVSTTSHEAILSNTKVLEIPLLPENSMRAVIDCAGILKLRNSDIELRKGETDI
GRKNTRVRLVFRVHVPQPSGRTLSLQVASNPIECSQRSAQELPLVEKQSTDSYPVMGGKK
MVLSGHNFLQDSKVIFVEKAPDGHHVWEMEAKTDRDLCKPNSLVVEIPPFRNQRITSPVH
VSFYVCNGKRKRSQYQRFTYLPANVPMIKTEPTDDYEPAPNCGPVSQGLSPLPRPYYSQQ
LAMPPDPSSCLVAGFPPCPQRSTLMPAAPGASPKLHDLSPAAYTKGVTSPGHCHLGLPQP
AGEAPAVQDVPRPVATHPGSPGQPPPALLPQQVSVPPSSSCPPGLEHSLCPSSPSPPLPP
AAQELTCLQPCSPACPPATGRPQHPPPTVRRDESPAAQPRLLPEACEDSSPNLAPIPVTV
KQEPEELDQLYLDDVNEIIRNDLSGTSTHS
NT seq 2793 nt   +upstreamnt  +downstreamnt
atgacggggctggaggaccaggagttcgacttcgagtttctcttcgagtttaaccagcgc
gacgagggcgccgccgcagccgccccagaacactatggctatgcgtcctccaatgtcagc
cctgccttgccgctccccacagcacactctaccctgccggccccatgccacaaccttcag
acctccacaccgggcatcgtccagccggcggatcacccctcggggtacggagcagctttg
gacggtgggcccacgggctacttcctctcctccggccacgccaggccagatggggcccct
gccctggagagtcctcgcatcgagataacctcatgcttgggtctgtaccacaacaacaac
cagtttttccacgatgtggaggtggaagacgtcctccccagctccaaacggtccccctcc
acggccacgctgagtctgcccagcctggaggcctacagagacccctcgtgcctgagcccg
gccagcagcctgtcctcccgcagctgcaactcagaggcctcctcctacgagtccaactac
tcgtacccgtacgcgtccccccagacgtcgccatggcagtctccctgcgtgtctcccaag
accacggaccctgaggagggctttccccgcgggctgggggcctgcacgctgctgggttcc
ccgcgacactccccctccacctcgccccgcgccagcgtcactgaggagagctggctgggt
gcccgctcctccaggcccgcgtccccgtgcaacaagaggaagtacagcctcaacggccgg
cagccgccctactcaccccaccactcgcccacgccgtccccgcacggctccccgcgggtc
agcgtgaccgacgactcgtggttgggcaacaccacccagtacaccagctcggccatcgtg
gccgccatcaacgcgctgaccactgacagcagcctggacctgggtgacggcgtccctgtc
aagtcccgcaagaccaccctggagcagccgccctcggtggcgctcaaggtggagcccgtc
ggggaggacctgggcagccccccgcccccggccgacttcgcgcccgaagacttctcctct
ttccagcacatcaggaagggcggcttctgcgaccagtacctggcggtgccgcagcaccca
taccagtgggcgaagcccaagcccctgtcccctgcgtcctacatgagcccaaccctgccc
gccctggactggcagctgccatcccactcgggcccgtacgagcttcggattgaggtgcag
cccaagtcccaccaccgagcccactacgagacggagggcagccggggggccgtgaaggcg
tcggctggaggacaccccatcgtgcagctccatggctacctggagagtgagccgctgatg
ctacagcttttcatcgggacggcggacgaccgcctgctgcgcccgcatgccttctaccag
gtgcaccgtatcacggggaagaccgtgtccaccaccagccacgaggccatcctctccaac
accaaagtcctggagatcccgctcctgccggagaacagcatgcgagccgtcattgactgt
gctggaatcctgaagctcagaaactccgacattgaacttcggaaaggagagacggacatc
gggaggaagaacacacgggtacggctggtgttccgtgttcacgtcccgcagcccagcggc
cgcacgctgtccctgcaggtggcctccaaccccatcgaatgttcccagcgctcggcccag
gagctgcctctggtggagaagcagagcacggacagctacccggtcatgggcggaaagaag
atggtcctgtccggccacaacttcctgcaggactccaaggtcattttcgtggagaaagcg
ccagatggccaccacgtctgggagatggaagcgaaaaccgatcgtgacctatgcaagccg
aattctctggtggttgagatcccgccgtttcggaatcagaggataaccagccctgttcac
gtcagtttctacgtctgcaacgggaagagaaagcgaagccagtaccagcgtttcacctac
cttcccgccaacgttccaatgataaaaacagaacccacggatgattatgagcctgctcca
aactgtgggccggtgagccaggggttaagtcctctcccaagaccatactacagccagcag
ctcgcgatgccacctgaccccagctcctgcctcgtggccggcttcccgccctgtccgcag
agaagcaccctgatgccagcagcccccggcgcgagccccaagctccacgacctttctccc
gccgcctacaccaagggcgtcaccagcccgggccactgccacctcggactcccgcagccg
gccggagaggcccccgccgtccaggacgtgcccaggccagtggccacgcaccccggctcg
cccgggcagccgcccccggccctgctgccgcagcaggtgagtgtgcctccaagcagtagc
tgcccccccggtctcgaacactcactctgccccagcagcccctctcctccactcccgccc
gccgcccaagagctgacctgcctgcagccctgcagcccagcgtgcccgcccgccacgggc
cgcccgcagcacccgccgcccacggtccgcagggatgagtctccggccgcccagccacgg
ctgctgcccgaggcgtgtgaggacagtagtcctaatttggcccctattcctgtaacggtc
aagcaagagcctgaagagttggaccagttgtacctggatgacgtaaatgaaataatacga
aatgacctctccggcacgagcacccactcctag

KEGG   Macaca mulatta (rhesus monkey): 702390
Entry
702390            CDS       T01028                                 

Gene name
NFATC3
Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 3 isoform X2
  KO
K17333  nuclear factor of activated T-cells, cytoplasmic 3
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04010  MAPK signaling pathway
mcc04022  cGMP-PKG signaling pathway
mcc04218  Cellular senescence
mcc04310  Wnt signaling pathway
mcc04360  Axon guidance
mcc04625  C-type lectin receptor signaling pathway
mcc04658  Th1 and Th2 cell differentiation
mcc04659  Th17 cell differentiation
mcc04660  T cell receptor signaling pathway
mcc04662  B cell receptor signaling pathway
mcc04921  Oxytocin signaling pathway
mcc05135  Yersinia infection
mcc05161  Hepatitis B
mcc05163  Human cytomegalovirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    702390 (NFATC3)
   04310 Wnt signaling pathway
    702390 (NFATC3)
   04022 cGMP-PKG signaling pathway
    702390 (NFATC3)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    702390 (NFATC3)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    702390 (NFATC3)
   04660 T cell receptor signaling pathway
    702390 (NFATC3)
   04658 Th1 and Th2 cell differentiation
    702390 (NFATC3)
   04659 Th17 cell differentiation
    702390 (NFATC3)
   04662 B cell receptor signaling pathway
    702390 (NFATC3)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    702390 (NFATC3)
  09158 Development and regeneration
   04360 Axon guidance
    702390 (NFATC3)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    702390 (NFATC3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    702390 (NFATC3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    702390 (NFATC3)
   05170 Human immunodeficiency virus 1 infection
    702390 (NFATC3)
   05161 Hepatitis B
    702390 (NFATC3)
   05163 Human cytomegalovirus infection
    702390 (NFATC3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    702390 (NFATC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcc03000]
    702390 (NFATC3)
Transcription factors [BR:mcc03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    702390 (NFATC3)
SSDB
Motif
Pfam: RHD_dimer RHD_DNA_bind TIG
Other DBs
NCBI-GeneID: 702390
NCBI-ProteinID: XP_014981940
Ensembl: ENSMMUG00000021843
UniProt: F7EIB3
LinkDB
Position
20
AA seq 1075 aa
MTTANCGAHDELDFKLVFGEDGAPAPPPPGSRPADLEPDDCASIYIFNVDPPPSTLNTPL
CLPHHGLPSHSSVLSPSFQLQSHKNYEGTCESPESKYSPLGGPKPFECPSIQITSISPNC
HQEIDAHEDDLQINDPEREFLERPSRDHLYLPLEPSYRESSLSPSPASSISSRSWFSDAS
SCESLSHIYDDVDSELNEAAARFTLGSPLTSPGGSPGGCPGEETWHQQYGLGHSLSPRQS
PCHSPRSSVTDENWLSPRPASGPSSRPTSPCGKRRHSSAEVCYAGSLSPHHSPVPSPGHS
PRGSVTEDTWLNASVHGGSGFGPAVFPFQYCVETDIPLKTRKTSEDQAAIVPGKLELCSD
DQGSLSLSRETSIDDGLGSQYPLKKDSSGDQFLSVPSPFTWSKPKPGHTPIFRTSSLPPL
DWPLPAHFGQCELKIEVQPKTHHRAHYETEGSRGAVKASTGGHPVVKLLGYNEKPINLQM
FIGTADDRYLRPHAFYQVHRITGKTVATASQEIIIASTKVLEIPLLPENNMSASIDCAGI
LKLRNSDIELRKGETDIGRKNTRVRLVFRVHIPQPNGKVLSLQIASIPVECSQRSAQELP
HIEKYSINSCSVNGGHEMIVTGSNFLPESKIIFLEKGQDGRPHWEVEGKIIREKCQGAHI
VLEVPPYHNPAVTAAVQVHFYLCNGKRKKSQSQRFTYTPVLMKQEHREEIDLSSVPSLPV
PHPAQTQRPSSDSGHSHDSVLSAQRSLVCSIPQTYASMVTSSHLPQLQCGDESASKEQHM
IPSPVVHQPFQVTPTPPVGSSYQPMQTNVVYNGPTCLPINAASSQEFDSVLFQQDATLPG
LVNLGCQPLSSIPFHSSNSGSTGHLLAHTPHSVHALPHLQSMGYHCSNTGQRSLSSPVAD
QISGQPSSQLQPVTYGPSHSGSATTASPAASHPLASSPLSGPPSPQLQSMPYQSPSSGTA
SSPSPATRMHSGQHSTQAQSTGQGGLSAPSSLICHSLCDPASFPPDGATVSIKPEPEDRE
PNFATIGLQDITLDDVNEIIGRDMSQISVSQGAGVSRQAPLLSPESLDLGRSDGL
NT seq 3228 nt   +upstreamnt  +downstreamnt
atgactactgcaaactgtggtgcccacgacgagctcgacttcaaactcgtctttggcgag
gacggggcgccggcgccgccgcccccgggctcgcggcctgcagatcttgagccagatgat
tgtgcatccatttacatctttaatgtagatccacctccatctactttaaacacaccactt
tgcttaccacatcatggattaccgtctcactcttctgttttgtcaccatcgtttcagctc
caaagtcacaaaaactatgaaggaacttgtgagagtcctgaatctaaatatagcccatta
ggtggtcccaaaccctttgagtgcccaagtattcaaattacatctatctctcctaactgt
catcaagaaatagatgcacatgaagatgacctacagataaatgacccagaacgggaattt
ttggaaaggccttctagagatcatctctatcttcctcttgagccatcctaccgggagtct
tctcttagtcctagtcctgccagcagcatctcttctaggagctggttctctgatgcatct
tcttgtgaatcactttcacatatttatgatgatgtggactcagagttgaatgaagctgca
gcccgatttacccttggatcccctctgacttctcctggtggctctccagggggctgccct
ggagaagaaacttggcatcaacagtatggacttggacactcattatcacccaggcagtct
ccttgccactctcctagatccagtgtcactgatgagaattggctgagccccaggccagcc
tcaggaccctcatcaaggcccacgtctccctgtgggaaacggaggcactccagtgctgaa
gtttgttatgctgggtccctttcaccccatcactcacctgttccttctcctggtcactcc
cccaggggaagtgtgacagaagatacctggctaaatgcttctgtccatggtgggtcaggc
tttggccctgcagtttttccatttcagtactgtgtagagactgacatccctctgaaaaca
aggaaaacttctgaagatcaagctgccatagtaccaggaaaattagagctctgttcagat
gaccaaggaagtttatcactatcccgggagacttcaatagatgatggccttggatctcag
tatcctttaaagaaagattcatctggtgatcagtttctttcagttccttcaccctttacc
tggagcaaaccaaagcctggccacacccctatatttcgcacatcatcattacctccacta
gactggcctttaccagctcattttggacaatgtgaactgaaaatagaagtgcaacctaaa
actcatcatcgagcccattatgaaactgaaggtagccgaggggcagtaaaagcatctact
gggggacatcctgttgtgaagctcctgggctataacgaaaagccgataaatctacaaatg
tttattgggacagcagatgatcgatatttacgacctcatgcattttaccaggtgcatcga
atcactgggaagacagtcgctactgcaagccaagagataataattgccagtacaaaagtt
ctggaaattccacttcttcctgaaaacaatatgtcagccagtattgattgtgcaggtatt
ttgaaactccgcaattcagatatagaacttcgaaaaggagaaactgatattggcagaaag
aatactagagtacgacttgtgtttcgtgtacacatcccacagcccaatggaaaagtcctt
tctctgcagatagcctctatacccgttgagtgctcccagcggtctgctcaagaacttcct
catattgagaagtacagtatcaacagttgttctgtaaatggaggtcatgaaatgattgtg
actggatctaattttcttccagaatccaaaatcatttttcttgaaaaaggacaagatgga
cgacctcattgggaggtagaagggaagataatcagggaaaaatgtcaaggggctcacatt
gtccttgaagttcctccatatcataacccagcagttacagctgcagtgcaggtgcacttt
tatctttgcaatggcaagaggaaaaaaagccagtctcaacgttttacttacacaccagtt
ttgatgaagcaagaacacagagaagagattgatttgtcttcagttccatctttgcctgtg
cctcatcctgctcagacccagaggccttcctctgattcagggcattcacatgacagtgta
ctgtcagcacagagaagtttggtttgttccatcccacaaacatatgcatccatggtgacc
tcatcccatctgccacagttgcagtgtggagatgagagtgctagtaaagaacagcatatg
attccttctccagttgtacaccagccttttcaagtcacaccaacacctcctgtggggtct
tcctatcagcctatgcaaactaacgttgtgtacaatggaccaacttgtcttcctattaat
gctgcctctagtcaagaatttgattcagttttgtttcagcaggatgcaactcttcctggt
ttagtgaatcttggctgtcaaccactgtcatccataccatttcattcgtcaaattcaggc
tcaacaggacatctcttagcccatacacctcattctgtgcatgccctgcctcatctacaa
tcaatgggatatcattgttcaaatacaggacaaagatctctttcttctccagtggctgac
cagattagcggtcagccttcttctcagttacaacctgttacatatggtccttcacattca
gggtctgctacaacagcttccccagcagcttctcatcccttggctagttcaccactttct
gggccaccgtctcctcagcttcagtctatgccttaccaatctcctagctcaggaactgcc
tcatcaccgtctccagccaccagaatgcattctggacagcactcaactcaagcacaaagt
acaggccaggggggtctttctgcaccttcatccttaatatgtcacagtttgtgtgatcca
gcttcatttccacctgatggggcaaccgtgagcattaaacctgaaccagaagatcgggag
cctaactttgcaaccattggtctgcaggacatcactttagatgatgtgaacgagataatt
gggagagacatgtcccagatttctgtttctcaaggagcaggggtgagcaggcaggctccc
cttctgagtcctgagtccctggatttaggaagatctgatggactctaa

KEGG   Macaca mulatta (rhesus monkey): 710601
Entry
710601            CDS       T01028                                 

Gene name
NFATC2
Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 2 isoform X1
  KO
K17332  nuclear factor of activated T-cells, cytoplasmic 2
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04022  cGMP-PKG signaling pathway
mcc04218  Cellular senescence
mcc04310  Wnt signaling pathway
mcc04360  Axon guidance
mcc04370  VEGF signaling pathway
mcc04380  Osteoclast differentiation
mcc04625  C-type lectin receptor signaling pathway
mcc04650  Natural killer cell mediated cytotoxicity
mcc04658  Th1 and Th2 cell differentiation
mcc04659  Th17 cell differentiation
mcc04660  T cell receptor signaling pathway
mcc04662  B cell receptor signaling pathway
mcc04921  Oxytocin signaling pathway
mcc05135  Yersinia infection
mcc05161  Hepatitis B
mcc05163  Human cytomegalovirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    710601 (NFATC2)
   04370 VEGF signaling pathway
    710601 (NFATC2)
   04022 cGMP-PKG signaling pathway
    710601 (NFATC2)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    710601 (NFATC2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    710601 (NFATC2)
   04650 Natural killer cell mediated cytotoxicity
    710601 (NFATC2)
   04660 T cell receptor signaling pathway
    710601 (NFATC2)
   04658 Th1 and Th2 cell differentiation
    710601 (NFATC2)
   04659 Th17 cell differentiation
    710601 (NFATC2)
   04662 B cell receptor signaling pathway
    710601 (NFATC2)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    710601 (NFATC2)
  09158 Development and regeneration
   04360 Axon guidance
    710601 (NFATC2)
   04380 Osteoclast differentiation
    710601 (NFATC2)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    710601 (NFATC2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    710601 (NFATC2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    710601 (NFATC2)
   05170 Human immunodeficiency virus 1 infection
    710601 (NFATC2)
   05161 Hepatitis B
    710601 (NFATC2)
   05163 Human cytomegalovirus infection
    710601 (NFATC2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    710601 (NFATC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcc03000]
    710601 (NFATC2)
Transcription factors [BR:mcc03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    710601 (NFATC2)
SSDB
Motif
Pfam: RHD_dimer RHD_DNA_bind TIG
Other DBs
NCBI-GeneID: 710601
NCBI-ProteinID: XP_015004264
Ensembl: ENSMMUG00000012657
UniProt: A0A1D5QLW3
LinkDB
Position
10
AA seq 925 aa
MNAPEQQPQPDGGDAPGHEPGGSPQDELDFSILFDYEYLNPNEEEPNAHKVASPPSGPAY
PDDVLDYGLKPYSPLASLSGEPPGRFGEPDRVGPQNFLSAAKPAGASGLSPRIEITPSHE
LIQAVGPLRMRDAGLLVEQPPLAGVAASPRFTLPVPGFEGYREPLCLSPASSGSSASFIS
DTFSPYTSPCVSPNNGGPDDLCPQFQNIPAHYSPRTSPIMSPRTSLAEDSCLGRHSPVPR
PASRSSSPGAKRRHSCAEALVALPPGASPQRSRSPSPQPSSHVAPQDHGAPAGYPPVAGS
AVIMDALNSLATDSPCGIPPKMWKTSPDPSPVSAAPSKAGLPRHIYPAVEFLGPCEQGER
RNSAPESILLVPPTWPKPLVPAIPICSIPVTASLPPLEWPLSSQSGSYELRIEVQPKPHH
RAHYETEGSRGAVKAPTGGHPVVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHRIT
GKTVTTTSYEKIVGNTKVLEIPLEPKNNMRATIDCAGILKLRNADIELRKGETDIGRKNT
RVRLVFRVHIPESSGRIVSLQTASNPIECSQRSAHELPMVERQDTDSCLVYGGQQMILTG
QNFTAESKVVFTEKTTDGQQIWEMEATVDKDKSQPNMLFVEIPEYRNKHIRTPVKVNFYV
INGKRKRSQPQHFTYHPVPAIKTEPTDEYDPTLICSPTHGGLGSQPYYPQHPMVAESPSC
LVATMAPCQQFRTGLSSPDARYQQQNPAAVLYQRSKSLSPSLLGYQQPALMAAPLSLADA
HRSVLVHAGSQGQSSALLHPSPTNQQASPVIHYSPTNQQLRCGSHQEFQHIMYCENFAPG
TTRPGPPPVSQGQRLSPGSYPTVIQQQNATSQRAAKNGPPVSDQKEVLPAGVTIKQEQNL
DQTYLDDVNEIIRKEFSGPPARNQT
NT seq 2778 nt   +upstreamnt  +downstreamnt
atgaacgcccccgagcagcagccccaacctgacggcggggacgccccaggccacgagccc
gggggcagcccccaagacgagcttgacttctccatcctcttcgactatgagtatttgaat
ccgaacgaagaagagccgaatgcacataaggtcgccagcccaccctccggacccgcatac
cccgatgatgtcctggactatggcctcaagccatacagcccccttgctagtctctctggc
gagccccccggccgattcggagagccggatagggtagggccgcagaactttctgagcgcg
gccaagccagcaggggcctcgggcctgagccctcggatcgagatcactccgtcccacgaa
ctgatccaggcagtgggccccctccgcatgagagacgcgggcctcctggtggagcagccg
cccctggccggggtggccgccagcccgaggttcaccctgcccgtgcccggcttcgagggc
taccgcgagccgctttgcttgagccccgctagcagcggctcctctgccagcttcatttct
gacaccttctccccctacacctcgccctgcgtctcgcccaataacggcgggcccgacgac
ctgtgtccgcagtttcaaaacatccctgctcattattcccccagaacctcgccaataatg
tcacctcgaaccagcctcgccgaggacagctgcctgggccgccactcgcccgtgccccgt
ccggcctcccgctcctcgtcgcctggtgccaagcggaggcattcgtgcgccgaggccttg
gttgccctgccgcccggagcctcaccccagcgctcccggagcccctcgccgcagccctca
tctcacgtggcaccccaggaccacggcgctcccgctgggtacccccctgtggctggctct
gccgtgatcatggatgccctgaacagcctcgccacggactcgccttgtgggatccccccc
aagatgtggaagaccagccctgacccctcgccggtgtctgcggccccatccaaggccggc
ctgcctcgtcacatctacccggccgtggagttcctggggccctgcgagcagggggagagg
agaaactcggctcccgaatccatcctgctggttccgcccacttggcccaagccgctggtg
cctgccattcccatctgcagcatcccagtgacggcatccctccctccacttgagtggccg
ctgtccagtcagtcaggatcttatgagctgcggatcgaggtgcaacccaagccacatcac
cgggcccactatgagacagaaggcagccgaggagccgtcaaagctccaactggaggccac
cctgtggttcagctccatggctacatggaaaacaagcctctgggacttcagatcttcatt
gggacagccgatgagcggatccttaagccgcatgccttctaccaggtgcaccgaatcacg
gggaaaactgtcaccaccaccagctatgagaagattgtgggcaacaccaaagtcctggag
atccccctggagcccaaaaacaacatgagggcaaccatcgactgtgcggggatcttgaag
ctcagaaacgccgacattgagctgcggaaaggcgagacggacattggaagaaagaatacg
cgggtgaggctggttttccgagttcacatcccagagtccagtggcagaatcgtctctttg
cagactgcatctaatcccatcgagtgctcccagcgatctgctcacgagctgcccatggtt
gaaagacaagacacggacagctgcctggtctacggcggccagcaaatgatcctcacgggc
cagaactttacggcggagtccaaagtcgtgtttactgagaagaccacagatgggcaacaa
atctgggagatggaagccacggtggataaggacaagagccagcccaacatgctttttgtt
gagatccctgaatatcggaacaagcacatccgcacacctgtaaaagtgaacttctacgtc
atcaatgggaagagaaaacgaagtcagcctcagcactttacctaccacccagtcccagcc
atcaagacggagcccacggatgaatatgaccccactctgatctgcagccccacccatgga
ggcctggggagccagccttactacccccagcacccgatggtggccgagtccccctcctgc
ctcgtggccaccatggctccctgccagcagttccgcacggggctctcatcccctgacgcc
cgctaccagcaacagaacccagcggccgtactctaccagcggagcaagagcctgagcccc
agcctgctgggctaccagcagccggccctcatggccgccccactgtcccttgcggacgct
caccgctctgtgctggtgcacgccggctcccagggccagagctccgccctgctccacccc
tctccgaccaatcagcaggcctcgcctgtgatccactactcacccaccaatcagcagctg
cgctgcggaagccaccaggagttccagcacatcatgtactgcgagaatttcgcaccaggc
accaccaggcctggcccgcccccggtcagtcaaggtcagaggctgagcccgggttcctac
cccacagtcattcagcagcagaatgccacgagccaaagagccgccaaaaacggacccccg
gtcagtgaccaaaaggaagtattacctgcgggggtgaccattaaacaggagcagaacttg
gaccagacctacttggatgatgttaatgaaattatcaggaaggagttttcaggacctcct
gccagaaatcagacgtaa

KEGG   Macaca mulatta (rhesus monkey): 714785
Entry
714785            CDS       T01028                                 

Gene name
NFATC4
Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 4 isoform X2
  KO
K17334  nuclear factor of activated T-cells, cytoplasmic 4
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04022  cGMP-PKG signaling pathway
mcc04218  Cellular senescence
mcc04310  Wnt signaling pathway
mcc04360  Axon guidance
mcc04625  C-type lectin receptor signaling pathway
mcc04921  Oxytocin signaling pathway
mcc05161  Hepatitis B
mcc05163  Human cytomegalovirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    714785 (NFATC4)
   04022 cGMP-PKG signaling pathway
    714785 (NFATC4)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    714785 (NFATC4)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    714785 (NFATC4)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    714785 (NFATC4)
  09158 Development and regeneration
   04360 Axon guidance
    714785 (NFATC4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    714785 (NFATC4)
   05170 Human immunodeficiency virus 1 infection
    714785 (NFATC4)
   05161 Hepatitis B
    714785 (NFATC4)
   05163 Human cytomegalovirus infection
    714785 (NFATC4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    714785 (NFATC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcc03000]
    714785 (NFATC4)
Transcription factors [BR:mcc03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    714785 (NFATC4)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer TIG
Other DBs
NCBI-GeneID: 714785
NCBI-ProteinID: XP_014998947
Ensembl: ENSMMUG00000003370
LinkDB
Position
7
AA seq 878 aa
MPASISSIFPELDSEDAPPCCRLALGEPPPYGAAPIGIPRPPPPRPGMHSPPPRPAPSPG
TWESQPARSVRLGGPGGGAGGAGGGRVLECPSIRITSISPTPEPPAALEDNPDTWGDGSP
RDYPPPEGFGGYREAGGQGGGAFFSPSPGSSSLSSWSFFSDASDEAALYAACDEVESELN
EAASRFGLGSPLPSPRASPRPWTPEDPWSLYGPSPGGRGPEDNWLLLSAPGPTPASPRPA
SPCGKRRYSSSGTPSSASPALSRRGSLGEEGSEPPPPPPLPLARDPGSPGPFDYVGAPPA
ESIPQKTRRTSSEQAVALPRSEEPAPCNGKLPLGAEESVAPPGGPRKEVAGMDYLAVPSP
LAWSKARIGGHSPIFRTSALPPLDWPLPSQYEQLELRIEVQPRAHHRAHYETEGSRGAVK
AAPGGHPVVKLLGYSEKPLTLQMFIGTADERNLRPHAFYQVHRITGKMVATASYEAVVSG
TKVLEMTLLPENNMAANIDCAGILKLRNSDIELRKGETDIGRKNTRVRLVFRVHVPQGGG
KVVSVQAASVPIECSQRSAQELPQVEAYSPSACSVRGGEELVLTGSNFLPDSKVVFIERG
PDGKLQWEEEATVNRLQSNEVTLTLTVPEYSNKRVSRPVQVYFYVSNGRRKRSPTQSFKF
LPVICKEEPLPDSSLRGFPSASAPPFGTDMDFSPPRPPYPSFPHEDPAYETPYLSEGFGY
GMPPLYPQTGPPPSYRPGLRMFPETRGTTGCAQPPPVSFLPRPFPSDPYGGRGSSFPLGL
PFSPPAPFRPPLPASPPLEVPFPSQSDVHPLPAEGYNKVGPGYGPGEGAPEQEKSRGGYS
SGFRDSVPIQGITLEEVSEIIGRDLSGFPAPPGDEPPA
NT seq 2637 nt   +upstreamnt  +downstreamnt
atgcctgcttcaatctcctccatcttcccagaactggactcagaggatgccccgccatgc
tgccgtctggccttgggagagccccctccctatggcgctgcacctatcggtattccccga
cctccaccccctcgacctggcatgcattcgccaccgccgcgcccagccccctcacctggt
acctgggagagccagcccgcccggtcggtgaggctgggaggaccaggagggggtgctggg
ggtgctgggggtggccgtgttctcgagtgtcccagcatccgcatcacctccatctctccc
acgccggagccgccggcggcgctggaggacaaccctgatacctggggggacggctctcct
agagattaccccccaccagaaggctttgggggctaccgagaggcagggggccagggtggg
ggggccttcttcagcccaagccctggcagcagcagcctgtcctcgtggagcttcttctcc
gatgcctctgacgaggcagccctgtatgcagcctgcgacgaggtggagtctgagctaaat
gaggcggcctcccgctttggcctgggctccccgctgccctcgcccagggcctcccctcgg
ccatggacccccgaagatccctggagcctgtatggtccaagccccggaggccgagggcca
gaggataactggctactcctcagtgctcctgggcccaccccagcctccccccgacctgcc
tctccatgtggcaagcggcgctattccagctcgggaaccccatcttcagcctctccagct
ctgtcccgccgtggcagcctgggggaagaggggtctgagccacctccaccacccccattg
cctctggcccgggatcctggctcccctggtccctttgactatgtgggggccccaccagct
gagagcatccctcagaagacacggcggacttccagcgagcaggcggtggctctgcctcgg
tctgaggagcctgccccatgcaatgggaagctgcccttgggagcagaggagtctgtggct
cctccaggaggtccccggaaggaggtggctggcatggactacctggcagtgccctcccca
ctcgcttggtccaaggcccggattgggggacacagccctatcttcaggacctctgcccta
cccccactggactggcctctgcccagccaatatgagcagctggagctgaggatcgaggta
cagcctagagcccaccaccgggcccactatgagacagaaggcagccgtggagctgtcaaa
gctgcccctggcggtcaccccgtagtcaagctcctaggctacagtgagaagccactgacc
ctacagatgttcatcggcactgcagatgaaaggaacctgcggcctcatgccttctatcag
gtgcaccgtatcacaggcaagatggtggccacagccagctatgaagccgtagtcagtggc
accaaggtgttggagatgactctgctgcctgagaacaacatggcggccaacattgactgt
gcgggaatcttgaagcttcggaattcagacattgagcttcggaagggtgagacggacatc
gggcgcaaaaacacacgtgtgcgactggtgttccgggtacacgtgccccagggcggcggg
aaggtcgtctcggtacaggcagcgtcggtgcccatcgagtgctcccagcgctcagctcag
gagctgccccaggtggaggcctacagccctagtgcctgctctgtgagaggaggcgaggaa
ctagtactgactggctccaacttcctgccagactccaaggtggtgttcattgagaggggt
cctgatgggaagctgcaatgggaggaggaggccacggtgaaccgactgcagagcaatgag
gtgacgctgaccctgactgtccctgagtacagcaacaagagggtgtcccggccagttcag
gtctacttttatgtctccaatgggcggaggaaacgcagtcctacccagagtttcaagttt
ctgcctgtgatctgcaaagaggagcctctaccagactcatctctgcggggcttcccttca
gcatcggcacccccctttggcactgacatggacttctcaccacccaggcccccctacccc
tcctttccccatgaagaccctgcttacgaaactccttacctatcagaaggcttcggctat
ggcatgccccctctgtacccccagacggggcccccaccatcctacagaccgggcctgcgg
atgttccctgagactaggggtaccacaggttgtgcccaaccacctccagtctccttcctt
ccccgccccttccctagtgacccctatggagggcggggctcctcttttcccctggggctg
ccattctctcctccagccccctttcggcctcctcttcctgcatccccaccgcttgaagtc
cccttcccttcccagagtgatgtgcatcccctacctgctgagggatacaataaggtaggg
ccaggctatggccctggggagggggctccggagcaggagaaatccaggggtggctacagc
agcggcttccgagacagtgtccctatccagggtatcacgctggaggaagtgagtgagatc
attggccgagacctgagtggcttccctgcacctcctggagacgagcctcctgcttga

DBGET integrated database retrieval system