KEGG   Macaca mulatta (rhesus monkey): 698148
Entry
698148            CDS       T01028                                 

Gene name
RAPGEF4
Definition
(RefSeq) rap guanine nucleotide exchange factor 4 isoform X1
  KO
K04351  Rap guanine nucleotide exchange factor 4
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04015  Rap1 signaling pathway
mcc04024  cAMP signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04261  Adrenergic signaling in cardiomyocytes
mcc04670  Leukocyte transendothelial migration
mcc04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    698148 (RAPGEF4)
   04072 Phospholipase D signaling pathway
    698148 (RAPGEF4)
   04024 cAMP signaling pathway
    698148 (RAPGEF4)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    698148 (RAPGEF4)
  09152 Endocrine system
   04911 Insulin secretion
    698148 (RAPGEF4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    698148 (RAPGEF4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    698148 (RAPGEF4)
Membrane trafficking [BR:mcc04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Rab associated proteins
    698148 (RAPGEF4)
SSDB
Motif
Pfam: RasGEF cNMP_binding DEP RasGEF_N
Other DBs
NCBI-GeneID: 698148
NCBI-ProteinID: XP_014965863
Ensembl: ENSMMUG00000020792
UniProt: A0A1D5QP16
LinkDB
Position
12
AA seq 1011 aa
MVAAHAAHSSSSAEWIACLDKRPLERSSEDVDIIFTRLKEVKAFEKFHPNLLHQICLCGY
YENLEKGITLFRQGDIGTNWYAVLAGSLDVKVSETSSHQDAVTICTLGIGTAFGESILDN
TPRHATIVTRESSELLRIEQKDFKALWEKYRQYMAGLLAPPYGVMETGSNNDRIPDKENT
PLIEPHVPLRPANTITKVPSEKILRAGKILRNAILSRAPHMIRDRKYHLKTYRQCCVGTE
LVDWMMQQTPCVHSRTQAVGMWQVLLEDGVLNHVDQEHHFQDKYLFYRFLDDEHEDAPLP
TEEEKKECDEELQDTMLLLSQMGPDAHMRMILRKPPGQRTVDDLEIIYEELLHIKALSHL
STTVKRELAGVLIFESHAKGGTVLFNQGEEGTSWYIILKGSVNVVIYGKGVVCTLHEGDD
FGKLALVNDAPRAASIVLREDNCHFLRVDKEDFNRILRDVEANTVRLKEHDQDVLVLEKV
PAGNRASNQGNSQPQQKYTVMSGTPEKILEHFLETIRLEATLNEATDSVLNDFIMMHCVF
MPNTQLCPALVAHYHAQPSQGTEQEKMDYALNNKRRVIRLVLQWAAMYGDLLQEDDVSMA
FLEEFYVSVSDDARMIAALKEQLPELEKIVKQISEDAKAPQKKHKVLLQQFNTGDERAQK
RQPIRGSDEVLFKVYCMDHTYTTIRVPVAASVKEVISAVADKLGSGEGLIIVKMSSGGEK
VVLKPNDVSVFTTLTINGRLFACPREQFDSLTPLPEQEGPTIGTVGTFELMSSKDLAYQM
TIYDWELFNCVHELELIYHTFGRHNFKKTTANLDLFLRRFNEIQFWVVTEICLCSQLSKR
VQLLKKFIKIAAHCKEYKNLNSFFAIVMGLSNVAVSRLALTWEKLPSKFKKFYAEFESLM
DPSRNHRAYRLTVAKLEPPLIPFMPLLIKDMTFTHEGNKTFIDNLVNFEKMRMIANTART
VRYYRSQPFNPDAAQANKNHQDVRSYVRQLNVIDNQRTLSQMSHRLEPRRP
NT seq 3036 nt   +upstreamnt  +downstreamnt
atggtcgctgcgcacgctgcccattcttcctcctccgccgagtggatcgcctgcctggat
aaaagaccattggagcgttccagcgaagatgtggatataatcttcactcgactgaaagaa
gttaaagcttttgagaaatttcacccaaatctccttcatcagatttgcttatgtggttat
tatgagaatctggaaaagggaataacattatttcgccagggtgatattggaacaaactgg
tatgctgtcttggcagggtctttggatgttaaagtatctgagaccagcagtcaccaggat
gccgtgaccatctgtaccctgggaattgggacggcctttggagagtccattctggacaac
acaccccgccatgcaaccatcgttaccagggagagcagtgaactgctccgcattgagcag
aaggacttcaaggcactatgggagaaatatcgacagtatatggcaggacttctggctcct
ccttatggtgttatggaaacgggctctaacaatgacaggattcctgacaaggagaacaca
cctctcattgaacctcacgttcctcttcgtcctgctaacaccattaccaaggtcccttca
gagaagatcctcagggctggaaaaattttacgaaatgccattctctctcgagcacctcac
atgataagagatagaaaataccacctaaagacatacagacaatgctgtgtgggaactgag
ctagtggactggatgatgcagcagacaccatgtgttcactcccggactcaagctgttggc
atgtggcaagtcctgttagaagacggtgttctcaaccacgtggaccaggagcaccatttc
caagacaaatatttgttctatcgatttctggatgacgagcacgaggatgcccctttgcct
actgaggaggagaagaaggagtgtgatgaggagctccaggacaccatgcttctgctgtca
cagatgggccctgacgcccacatgaggatgatcctccgcaaaccacctggccagaggact
gtggatgacctggagattatctatgaggagcttcttcatattaaagccttatcccatctt
tctaccacagtgaaacgagagttagcaggtgttctcatttttgagtctcatgccaaagga
gggaccgtgttgtttaaccagggggaagaaggtacctcctggtacattattctaaaagga
tcagtgaatgtagtcatttatggcaagggtgtggtctgcaccctgcatgaaggagatgac
ttcggcaagttagcactagtgaatgatgccccacgagctgcctctatcgtcttacgagaa
gataattgccatttcttaagagtagacaaggaggatttcaaccggatcctgagggacgtg
gaggcgaatacagtcagacttaaagaacatgaccaagatgtcttggtgctggagaaggtc
ccagcagggaacagagcttctaatcaaggaaactcacagcctcagcaaaagtatactgtg
atgtcaggaacacctgaaaaaattttagagcattttctagaaacgatacgccttgaggca
actttaaatgaagcaacagattctgttttaaatgactttattatgatgcactgtgttttt
atgccaaatacccagctttgcccagccctggtggcccattaccacgcacagccttcacaa
ggtacagaacaggagaaaatggattatgccctcaacaataagaggcgagtcatccgcctg
gttctacagtgggctgccatgtatggagacctcctacaagaggatgatgtgtctatggcc
tttctggaggagttttatgtatctgtatcagatgatgcccggatgattgctgccctcaag
gagcaactgccggagttggagaagattgtcaagcaaatctcagaagatgcaaaggcacca
caaaagaagcacaaggttcttttgcaacagttcaatacaggtgatgagagagcccagaag
cgccagcctatccgtggctctgatgaagttctgtttaaggtctattgcatggaccacacc
tacacaaccattcgggtgccagtggccgcctcggtgaaggaagtcatcagcgccgttgcc
gacaagctgggctctggggagggcctgatcatagtcaagatgagttctggaggagaaaag
gtggtgctcaaacctaatgatgtttcagtatttacgacgctcaccattaatggacgcctg
tttgcttgcccgcgagagcaattcgattcactgactcccttaccagaacaggaaggccca
actattggaacagtgggaacttttgaactgatgagctccaaagatttagcataccagatg
acaatttatgattgggaactcttcaactgcgtgcatgagctggagctaatctatcacaca
tttggaaggcataattttaaaaagaccacagcaaacttggatttgttcctgaggagattt
aatgaaattcagttttgggtcgtcactgagatctgcctttgttctcagctaagcaagcgt
gttcagctattaaaaaaatttattaagatagcagcccactgtaaggagtataaaaatctg
aattccttttttgccatcgtcatgggactaagtaacgttgctgtgagccgcttggcacta
acgtgggagaaactgccaagcaagttcaagaagttctatgcggagtttgaaagtttaatg
gacccttcaaggaaccacagggcctacaggctgacggtagctaagctggaaccgcctctc
atccccttcatgcctttgctcattaaagatatgacatttactcatgaggggaacaagacg
ttcattgacaatctagtaaactttgaaaaaatgcgcatgattgcaaatacggccagaaca
gtgagatactacaggagccaacccttcaatcctgatgcagctcaagctaataagaaccat
caggatgtccggagttatgtacggcaattaaatgtgattgacaaccagagaactttatca
cagatgtcacacagattagagcctcgtcgaccatag

KEGG   Macaca mulatta (rhesus monkey): 703967
Entry
703967            CDS       T01028                                 

Gene name
RAPGEF3
Definition
(RefSeq) rap guanine nucleotide exchange factor 3 isoform X2
  KO
K08014  Rap guanine nucleotide exchange factor 3
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04015  Rap1 signaling pathway
mcc04024  cAMP signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04261  Adrenergic signaling in cardiomyocytes
mcc04670  Leukocyte transendothelial migration
mcc04720  Long-term potentiation
mcc04726  Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    703967 (RAPGEF3)
   04072 Phospholipase D signaling pathway
    703967 (RAPGEF3)
   04024 cAMP signaling pathway
    703967 (RAPGEF3)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    703967 (RAPGEF3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    703967 (RAPGEF3)
  09156 Nervous system
   04726 Serotonergic synapse
    703967 (RAPGEF3)
   04720 Long-term potentiation
    703967 (RAPGEF3)
SSDB
Motif
Pfam: RasGEF cNMP_binding RasGEF_N DEP BES1_N
Other DBs
NCBI-GeneID: 703967
NCBI-ProteinID: XP_015007026
Ensembl: ENSMMUG00000000477
LinkDB
Position
11
AA seq 923 aa
MKVGWPGESCWQVGLAVEDSPALGAPRVGPLPDVVPEGTLLNMVLRKMHRPRSCSYQLLL
EHQPPSCIQGLRWTPLTNSEESLDFSESLEQASTERVFRAGRQLHRQLLATCPNLIRDRK
YHLRLYRQCCSGRELVDGILALGLGVHSRSQVVGICQVLLDEGALCHVKHDWAFQDRDAQ
FYRFPGPEPEPVGAHEMEEELAEAVALLSQRGPDALLTVALRKPPGQRMDEELDLIFEEL
LHIKAVAHLSNSVKRELAAVLLFEPHSKAGTVLFSQGDKGTSWYIIWKGSVNVVTHGKGL
VTTLHEGDDFGQLALVNDAPRAATIILREDNCHFLRVDKQDFNRIIKDVEAKTMRLEEHG
KVVLVLERASQGAGPSRPPTPGRNRYTVMSGTPEKILELLLEAMGPDSSAHDPTETFLSD
FLLTHRVFMPSAQLCAALLHHFHAEPAGGSEQERSTYICNKRQQILRLVSQWVALYGSML
HTDPVATSFLQKLSDLVGRDARLSNLLREQWPERRRHHRLENGCGNASPQMKARNLPVWL
PNQDEPLPGSSCAIRVGDKVPYDICLPDHSVLTLQLPVTASVREVMAALAQEDGWTKEQV
LVKVNSAGDAIGLQPDARGVATSLGLNERLFVVNPQEVHELTPHPDQLGPTVGSAEGLDL
VSAKDLAGQLTDHDWSLFNSIHQVELIYYVLGPQHLRDVTTANLERFMRRFNELQYWVAT
ELCLCPVPGPRAQLLRKFIKLAAHLKEQKNLNSFFAVMFGLSNSAISRLAHTWERLPHKV
RKLYSALERLLDPSWNHRVYRLALAKLSPPVIPFMPLLLKDMTFIHEGNHTLVENLINFE
KMRMMARAARMLHHCRSHNPVPLSPLRSRVSHLHEDSQVARISTCSEQSLSTRSPASTWA
YVQQLKVIDNQRELSRLSRELEP
NT seq 2772 nt   +upstreamnt  +downstreamnt
atgaaggtgggctggccaggtgagagctgctggcaggtgggcctggctgtggaggatagc
ccagctctgggagcaccgcgggtgggacccctccctgacgtggtgccggaggggacacta
ctcaacatggtgttgaggaagatgcaccggccccgaagctgctcctaccagctgctgctg
gagcaccagcctccgagctgcatccaggggctgcgctggacaccactcaccaacagcgag
gagtccctggatttcagcgagagcctggagcaggcctccacagagcgggtgttcagggct
gggaggcagctgcatcggcaactgctggccacctgcccaaacctcatccgagaccggaag
taccaccttaggctctatcggcagtgctgctctggccgggagctggtggatgggatcttg
gccctgggacttggggtccattcccggagccaagttgtgggaatctgccaggtgctgctg
gatgaaggtgccctctgccatgtgaaacacgactgggccttccaggaccgagatgcccaa
ttctaccggttccccgggcccgagcccgagcccgtgggagctcatgagatggaggaggag
ttggctgaagctgtggccctgctctcccagcgggggcctgacgccctgctcactgtggca
cttcgaaagcccccaggtcagcgcatggatgaagagctggacctcatctttgaggagctg
ctgcacatcaaggctgtagcccacctctccaactcggtgaagcgagaattagcggctgtt
ctgctctttgaaccacacagcaaggcagggaccgtgttgttcagccagggggacaagggc
acttcatggtacattatctggaagggatctgtcaacgtggtgacccatggcaaggggctg
gtgaccaccctgcatgagggagatgactttggacagctggctctggtgaatgatgcaccc
cgggcagccaccatcatcctgcgagaagacaactgtcatttcctgcgtgtggataagcag
gacttcaaccgtatcatcaaggatgtggaggcaaagaccatgcggctggaagaacatggc
aaagtggtgctggtgctggagagagcctctcagggcgccggcccatctcgacccccaacc
ccaggcaggaaccggtatacagtgatgtctggtaccccagagaagatcctagagctcctg
ttggaggccatgggaccagattccagtgctcatgacccaacagagacattcctcagcgac
ttcctcctgacccacagggtcttcatgcccagcgcccaactctgtgccgcccttctgcac
cacttccatgcggagcctgcgggtggcagtgagcaggagcgcagcacctacatctgcaac
aagaggcagcagatcctgcggctggtcagccagtgggtggccctgtatggctccatgctc
cacactgaccctgtggctaccagcttcctccagaaactctcggacctggtgggcagggac
gcccgactcagcaacctgctgagggagcagtggccagagaggcggcgacaccacaggttg
gagaacggctgtgggaatgcatctcctcagatgaaggcccggaacttgcctgtttggctc
cccaaccaggacgagccccttcctggcagcagctgtgccatccgagttggggataaagtc
ccctatgacatctgcctgccagaccactcagtgttgaccctgcagctgcctgtgacagcg
tctgtgagagaggtgatggcggcgttagctcaggaggatggctggaccaaggagcaggtg
ctggtgaaggtcaattctgcaggtgatgccattggcctgcagccagatgcccgtggtgtg
gccacatctctggggctcaatgagcggctctttgttgtcaacccacaggaagtgcatgag
ctgaccccacaccctgaccagctggggcccactgtgggctctgctgaggggctggacctg
gtgagtgccaaggacctggcaggccagctgacggaccacgactggagcctcttcaacagc
atccaccaggtggagctaatttactatgtgctgggcccccagcatctgcgggatgtcacc
accgccaacctggagcgcttcatgcgccgcttcaacgagctgcagtactgggtggccacc
gagctgtgtctctgcccggtgcccggcccccgggcccagctgctcaggaagttcattaag
ctggcggcccacctcaaggagcagaagaatctcaattccttctttgccgtcatgtttggc
ctcagcaactcagccatcagccgcctagcccacacctgggagcggctgccgcacaaagtc
cggaagctgtactctgccctcgagaggctgctggatccctcatggaaccaccgggtgtac
cgactggccctcgccaagctctcccctcctgtcatccccttcatgccccttcttctcaaa
gacatgaccttcattcatgagggaaaccacacactagtggagaacctcatcaactttgag
aagatgagaatgatggccagagccgcgcggatgctgcaccactgccgaagccacaaccct
gtgcctctctcaccactcagaagccgagtttcccatctccacgaggacagccaggtggcg
aggatttccacatgctcggagcagtccctgagcacccggagtccagccagcacctgggct
tatgtccagcagctgaaggtcatcgacaaccagcgggaactctcccgcctctcccgagag
ctggagccatga

DBGET integrated database retrieval system